KEGG   Mycolicibacterium goodii: AFA91_00010Help
Entry
AFA91_00010       CDS       T04008                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
mgo  Mycolicibacterium goodii
Pathway
mgo00020  Citrate cycle (TCA cycle)
mgo00620  Pyruvate metabolism
mgo01100  Metabolic pathways
mgo01120  Microbial metabolism in diverse environments
mgo01200  Carbon metabolism
mgo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFA91_00010
   00620 Pyruvate metabolism
    AFA91_00010
Enzymes [BR:mgo01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     AFA91_00010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp Biotin_lipoyl_2 RnfC_N ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AKS30521
UniProt: A0A0K0WZA4
Position
complement(6050..9457)
Genome map
AA seq 1135 aa AA seqDB search
MTAKMLVANRGEIAIRAFRAANELGITTVAVYPHEDRNSPHRLKADEAYQIGEHGHPIRA
YLSVKEMLRVAKSAGADAIYPGYGFLSENPALATACERAGITFVGPPPDVLELTGNKARA
ITVAREAGLPVLVSSAPSAEPEVLLSAAEDMRFPVFVKAVAGGGGRGMRRVSDRSGLRDA
IEVASREAESVFGDPTVFLEEAVVNARHIEVQILADHDGNVIHLFERDCSIQRRHQKVIE
MSPAPGLDPALRQRLCADAVAFAKKIGYSGAGTVEFLVAPDDRHVFIEMNPRIQVEHTVT
EEVTDVDLVQAQIRIAAGATLPELGLTQDAISLRGAALQCRITTEDPTNDFRPDTGRITA
YRTPGGAGVRLDGGTFVGAEVPAHFDSMLVKLTCRGTDFPAAVARARRAVAEFRIRGVAS
NIPFLQAVLDDPDFGAGRVTTSFIGERPHLLDSCGSADRGTKILNYLAEVTVNRPHGQQR
VTAYPHEKLPVVDLTAPPPPGSRQRLKELGPAGFAAVLREQKALAVTDTTFRDAHQSLLA
TRVRTRDLLGVAGHVARTTPELLTLEVWGGATFDVALRFLFEDPWERLAALREAVPNICL
QMLLRGRNTVGYTPYPEMVTSAFVAEAAATGVDVFRIFDALNDVDQMRPAIDAVLENGST
VAEVAMSYTGDVMNPDERLYNLDYYLRLAERIVSTGAHVLAIKDMAGLLRAPAATRLVSA
LRERFDLPIHVHTHDTPGGQLATYLAAVEAGADAVDGASAPLAGTTSQPALAAIVAATAH
TTHDTGLNLAAVCALEPYWEAVRRLYTPFESGLPAPTGRVYRHEMPGGQLSNLRQQALAL
GLGDPFEDIETSYADADRALGRLVKVTPSSKVVGDLALALVAAGMPIDVFTSDPSKLDIP
ESVIGFLSGELGTPPGGWPEPLRTRALEGQRVAPRRRSPLSEADEEALAGDSPKRRAALN
RLLFPGPAREFDEHLQRYGDTSGLPSYQFFYGLRQGEEHHVDLEPGVTLLIGLEAISEPD
ERGFRTVMCLLNGQLRPVRVRDRSVATDQPASERVDPANPAHIGAPFAGTVSLVVTPGDS
VAVGDVIATIEAMKMEASITAPRSGVIERTAIATVQQVEGGDLIAVLSTAGVAAD
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcgaagatgcttgtggccaaccgcggcgagatcgcgatccgggcgttccgcgcg
gccaacgaattgggcatcaccacggtcgcggtctacccgcacgaagaccgcaattccccg
caccggctcaaagccgacgaggcctatcagatcggtgaacacggacacccgatccgggcg
tacctgtcggtgaaggagatgcttcgggtcgcgaaatcggccggggcagacgcgatctac
ccgggatatggcttcttgtcggagaatccggcgctcgcgacggcgtgcgagcgtgcgggt
atcaccttcgtcggcccgccgcctgatgtgctggagctgaccgggaacaaagctcgggcg
atcacggtggctcgtgaagctggtctgccggtcctggtttcgtcggcaccgtcagccgaa
ccggaggtgctgctctccgcggcggaggacatgcggttcccggtcttcgtgaaagcggtc
gcgggtggcggagggcgcgggatgcggcgggtatcggacagatccgggttacgggatgcg
atcgaggtcgcctcaagggaggcagagtccgtgttcggtgacccgacggtgttcctcgaa
gaggccgtggtgaacgcgcggcacatcgaggttcagatcttggccgatcatgacggaaac
gtgatccatctgttcgagcgcgactgctcgatacaacgtaggcatcagaaggtgatcgag
atgtcgcctgcgcccggtcttgacccggcgcttcggcagcggctgtgcgccgatgcggtg
gcgttcgcgaaaaagatcggatacagcggcgccggtaccgtcgagttcctggtggcgcca
gacgatcgccacgtgttcatcgagatgaacccgcgcatccaggttgagcacacggtgacc
gaggaggtgaccgacgtcgatctggtgcaggcgcagatccgcatcgcggccggcgccacc
ctgcccgagttggggctgactcaggacgcgatcagtctgcgtggagccgccctgcagtgc
cgcatcaccacagaggacccgaccaacgacttccggccggataccggccggatcaccgcc
taccgcacacccggtggcgccggtgtgcgactcgacggaggcaccttcgtcggggccgag
gtaccggcccatttcgactcgatgctggtaaaactcacctgccgcgggaccgacttccct
gccgcggttgcccgggcgaggcgggcggtggctgagttccggattcgtggtgtggccagt
aacatcccgttcctgcaggcggtgctcgatgatccggatttcggtgcaggccgcgtgacg
accagcttcatcggtgagcgcccacacctgttggactcgtgtggttcggccgatcgtgga
acgaagattctcaactacctggcagaggtgaccgtcaaccggccgcacgggcaacagcgg
gtgacggcgtatccgcacgagaagctgccggtggtggatctgacggcgccaccaccgccg
ggctcacggcagcggctgaaggagctggggccggccggctttgccgcggtgctacgcgag
cagaaagcgttggcggtcaccgacaccacgttccgggacgcgcatcagtcgctgttggca
acccgggtccggacccgggacctgctcggggtggccgggcacgtggcccgcaccacgccg
gaattgttgacgctggaggtgtggggtggtgccaccttcgacgtggcgttgcgcttcctg
ttcgaggacccttgggagcgactggcagcgttgcgggaggccgtgccaaacatctgcctg
cagatgctgctgcgcggtaggaacaccgtgggatatacgccgtatccggagatggtgacc
agtgccttcgtcgccgaggcagccgcgacaggggtggacgttttccgaatcttcgacgcg
ctcaacgatgttgaccagatgaggccggcgatcgacgccgttctggaaaacggcagcacg
gtcgcagaggtggcgatgagctacaccggtgacgtcatgaaccctgacgagcggctgtac
aacctggactactacctgcggttggcagagcggatcgtgtcgaccggtgcgcacgttctg
gcgatcaaggacatggccggactgctgcgcgcaccggccgccacccggctggtgagcgcg
ttgcgcgagcggttcgatttgccgatccacgttcatacacatgacacgccgggcgggcag
ctggcgacctatcttgctgccgtggaggcgggcgccgacgcggtggacggggccagcgcg
ccgttggcggggacgacgagccaacctgctctggcggcgatcgtcgccgcgacggcacac
accacccacgacaccggtctcaaccttgcggcagtgtgcgccttggagccgtactgggag
gcggtgcgcaggctgtatacgccgttcgagtccggtctgccggcaccgaccgggcgggtg
taccgacacgagatgccgggcggacagctgtccaatctgcggcagcaagcactcgcgctc
gggttgggtgacccgttcgaggacatcgagaccagctacgccgacgcggatcgggcactc
ggtcggctggtgaaggtgaccccgagctcgaaggtcgtcggtgatctggcgttggcgctc
gtcgccgcaggcatgccgatcgacgtattcacctcggacccgtcgaaactggacatcccg
gagtcagtcatcggtttcttaagtggagagttgggcaccccgccgggcgggtggcctgag
ccgctacggacgcgcgccctcgagggacaaagggtcgcaccgcgtcgtcgatcgccgctg
tcggaggcggacgaggaggcactcgccggtgactcgccaaagcggcgcgcagcattgaac
cggttgctgttcccggggccggctcgggagttcgacgagcacctgcagcgatacggcgac
acgtccgggttgccgtcgtatcaattcttctacgggctacggcaaggcgaagagcatcac
gtcgacctcgagccgggtgtaacgctactgatcggcctcgaggcgatcagcgaacccgac
gagcgaggatttcggaccgttatgtgcctactcaacgggcaactgcggcccgttcgagtg
cgggaccggtcggtggccaccgatcaacccgcctccgagcgggtggaccccgccaatcct
gcccacatcggggcgccgttcgccgggactgtctccttggtggtcacccccggcgacagc
gtggccgtcggcgatgtgatcgccaccatcgaagcaatgaagatggaagcctccatcacc
gcgccccgctcgggggtgattgaacggaccgccatcgccacggtgcaacaagtcgaaggc
ggcgacctcatcgcggtcctgtcaaccgccggagttgccgccgactga

DBGET integrated database retrieval system