KEGG   Mycolicibacterium goodii: AFA91_00160Help
Entry
AFA91_00160       CDS       T04008                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mgo  Mycolicibacterium goodii
Brite
KEGG Orthology (KO) [BR:mgo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AFA91_00160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 OPA3 DUF4131
Motif
Other DBs
NCBI-ProteinID: AKS30546
UniProt: A0A0K0WZC7
Position
complement(36886..38136)
Genome map
AA seq 416 aa AA seqDB search
MSAELVVLVLLIATALAFDFTNGFHDTGNAMATSIATRALKPKTAVLLAGVLNLVGAFLS
VEVAVTVTSSVLKIQDSKSGALVGSIDASTGLTIIFAGLIGGILWNLLTWLFGIPSSSSH
ALFGGLIGAGLAAIGLAGVNWAGVTQKVLIPAVAAPVIACLVAACGTWLVYRITRNVAQK
RREKGFRWGQIATASLVALSHGTNDAQKTMGVIALALITTGHLSGDVKENGLPFWIIASC
ALAIGLGTYLGGWRVIRTLGKGLVEIESPQGLAAEASSAAIILSSSAAGMALSTTHVATG
SILGSGVGKPGAEVRWAVAGRMAVAWLVTLPAAGIVGALAFWLSHGVETLTGSSLAGDGL
IFLVLVGLSFYMWWRAQQQKVDHSNVNADWDESTNSVVPVEVREAAKADTRATAGV
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagagcttgtcgtgttggtgctgctgatagcaaccgcactcgctttcgacttc
accaacggcttccacgacaccggcaatgcgatggccacctcgatcgcaacccgtgcgctc
aagcccaagaccgcggtgctgctggccggtgtactcaacctggtcggcgcgttcctctcg
gtggaggtcgcggtcaccgtcaccagttcggtgctcaagatccaggactcgaagtccggc
gcgctcgtcggctcgatcgacgcctcgacggggctgacgatcatcttcgccggcctcatc
ggcggcatcctgtggaatctgctgacgtggctgttcggcatcccgtcgagttcctcgcac
gccctgttcggcgggctgatcggcgccggtctggccgcgatcggcctcgccggtgtcaac
tgggccggcgtcacccagaaggtgctgatccccgcggtcgccgccccggtcatcgcgtgc
ctggtcgccgcctgcggcacgtggctggtctaccgcatcacccgcaacgtcgcccagaag
cgccgcgaaaaaggcttccgctggggccagatcgcgacggcgtcgcttgtcgcgctgtcg
cacggcaccaacgacgcgcagaagaccatgggcgtcatcgcgctcgcgctgatcaccacc
ggccacctctccggcgacgtcaaggagaacggcctgccgttctggatcatcgcctcctgc
gcgctggccatcggcctgggcacctacctcggcggctggcgcgtcatccgcacgttgggc
aagggcctcgtcgagatcgagtcaccgcagggcctggccgcggaagcgtcttcggccgcg
atcatcctgagctccagcgccgccggtatggcgttgtccaccacccacgtcgccaccggt
tcgatcctgggcagcggcgtcggcaagcccggtgccgaggtgcgctgggccgtggccgga
cgcatggcggtggcctggctggtgaccctgcccgccgcgggcatcgtcggcgccctcgcg
ttctggctgtcccatggtgtcgagacgctgaccggctcgtcgctggccggtgacggcctg
atcttcctggtgctcgtcgggctgtccttctacatgtggtggcgcgcgcagcagcagaag
gtggaccacagcaacgtcaacgccgattgggacgagtccaccaactcggtcgtgcctgtc
gaggtgcgcgaggccgccaaggccgacacccgcgccaccgcgggcgtctga

DBGET integrated database retrieval system