KEGG   Mycolicibacterium goodii: AFA91_10810Help
Entry
AFA91_10810       CDS       T04008                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mgo  Mycolicibacterium goodii
Pathway
mgo00071  Fatty acid degradation
mgo00072  Synthesis and degradation of ketone bodies
mgo00280  Valine, leucine and isoleucine degradation
mgo00310  Lysine degradation
mgo00362  Benzoate degradation
mgo00380  Tryptophan metabolism
mgo00620  Pyruvate metabolism
mgo00630  Glyoxylate and dicarboxylate metabolism
mgo00640  Propanoate metabolism
mgo00650  Butanoate metabolism
mgo00900  Terpenoid backbone biosynthesis
mgo01100  Metabolic pathways
mgo01110  Biosynthesis of secondary metabolites
mgo01120  Microbial metabolism in diverse environments
mgo01130  Biosynthesis of antibiotics
mgo01200  Carbon metabolism
mgo01212  Fatty acid metabolism
mgo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mgo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFA91_10810
   00630 Glyoxylate and dicarboxylate metabolism
    AFA91_10810
   00640 Propanoate metabolism
    AFA91_10810
   00650 Butanoate metabolism
    AFA91_10810
  Lipid metabolism
   00071 Fatty acid degradation
    AFA91_10810
   00072 Synthesis and degradation of ketone bodies
    AFA91_10810
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AFA91_10810
   00310 Lysine degradation
    AFA91_10810
   00380 Tryptophan metabolism
    AFA91_10810
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AFA91_10810
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AFA91_10810
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AFA91_10810
Enzymes [BR:mgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AFA91_10810
Exosome [BR:mgo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFA91_10810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKS32286
UniProt: A0A0K0X4J5
Position
complement(2315052..2316215)
Genome map
AA seq 387 aa AA seqDB search
MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVEKAGIDAADVEQIIGGCVTQYG
EQSNNITRVGWLTAGLPEHVGATTIDCQCGSAQQANHLVAGLIATGAIDIGIACGVEAMS
RVGLGANAGPDRSLIRASSWDIDMPNQFEAAERIAKRRGITRADVDALGVASQRKARQAW
DEGRFDREVSPISAPVLDENKQPTSQWAPVTRDQGLRETTPEALASLKPVLDGGIHTAGT
SSQISDGAAAVLWMDESVAKAQGLKPRARIVAQANVGAETYYHLDGPVQSTAKVLEKAGM
KLGDIDLVEINEAFASVVLSWAQVHNADMDKVNVNGGAIALGHPVGSTGARLITTALHEL
ERTGKGTALITMCAGGALSTGTIIERI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatcctgtcatcgtcgaggccacccgcagcccgatcggtaaacgcaatggatgg
ttgtccggtctgcacgccacggaactgctcggagccgtgcagaaggcgctggtggaaaag
gcgggcatcgacgccgcagacgtcgagcagatcatcggtggctgcgtcacccagtacggc
gagcagtccaacaacatcacccgcgtgggttggctgaccgctggattgcccgagcacgtc
ggcgcgaccaccatcgactgccagtgcggcagcgcccagcaggccaaccacctcgtggcg
ggcctgatcgcgaccggcgccatcgacatcggcatcgcgtgcggcgtggaggcgatgagc
cgcgtgggcctcggcgccaacgcaggccccgaccgctcgctgatccgcgcgtcgtcgtgg
gacatcgacatgcccaaccagttcgaggccgccgagcgcatcgccaagcggcgcggcatc
acgcgggcagacgtcgacgcgctcggcgtggcctcgcagcgcaaggccaggcaggcgtgg
gacgaaggtcggttcgaccgcgaggtctcccccatctcggctcccgtgctcgacgagaac
aaacagcccacctcccagtgggcacccgtgacccgcgaccaggggctgcgcgagaccaca
ccggaggcgctcgcgtcgctgaaacccgtgctggacggcggcattcacaccgcgggcacg
tcgtcgcagatctccgacggtgcggccgcggtgctgtggatggacgagtcggtggcaaaa
gcgcaaggcctcaaaccgcgggcccgcatcgtcgcgcaggccaacgtcggcgcggagacc
tactaccacctcgacggcccggtgcagtccaccgccaaggtgctggagaaggcgggtatg
aagctcggcgacatcgacctcgtcgagatcaacgaggcgttcgcgtcggtggtgctgtcg
tgggcgcaggtgcacaatgccgacatggacaaggtgaacgtcaacggcggcgcgatcgcg
ctgggccaccctgtcggctcgaccggcgcccgcctgatcaccacggcgctgcacgaactc
gagcgcaccggcaagggcaccgcgctgatcaccatgtgcgccggcggcgccctgtccacc
ggcaccatcatcgagcgcatctag

DBGET integrated database retrieval system