KEGG   Mycolicibacterium goodii: AFA91_15405Help
Entry
AFA91_15405       CDS       T04008                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mgo  Mycolicibacterium goodii
Pathway
mgo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AFA91_15405
Enzymes [BR:mgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AFA91_15405
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AFA91_15405
    1.1.1.-  
     AFA91_15405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AKS33058
UniProt: A0A0K0X6U0
Position
3256036..3257082
Genome map
AA seq 348 aa AA seqDB search
MKAAVYHGPNKLEIADVAEPQPGPGTVKVKVGFNGICGTDLHEYYAGPIFVPTEPHPLTG
REMPLTMGHEFAGTITDIGAGVTGYAPGDRVAIEPIYRCGHCAPCRAGTYNVCQQIGFHG
LMCDGGMAEYTVVPVNMLHKLPDNVSLELGALVEPMSVAYHAATLGDVSAGDTAVVFGAG
PIGIGLWFALRGKGLESVYVAEPSPTRRAAIEALGATTLDPTQVDVPGFIADVTGGRGAD
AAFDAAGVAPAIEAATASVGSRRPTVSVAIYEKPLTTPLLNLVMNESRIQGSLCYTSADF
EAVIALMADGVYDTTGWVTRIGIDDVVDEGFEALHAGRKMKVLVDPAV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgccgtctatcacggacccaacaaactcgagatcgccgatgtcgccgaaccg
caaccagggccgggcacggtcaaggtgaaggtcggattcaacggaatctgcgggactgac
ctgcatgaatactatgcgggcccgatcttcgtgcccaccgaaccgcacccgctcaccggc
cgggagatgccgttgaccatggggcacgagttcgcaggcaccatcaccgacatcggtgcg
ggtgtcaccggttacgcgccgggggaccgcgtcgcgatcgagccgatctaccggtgcggc
cactgcgcgccatgccgcgcgggcacctacaacgtgtgccagcagatcggtttccacggc
ctgatgtgcgacggcggcatggccgaatacaccgtcgtcccggtcaacatgctgcacaaa
ctgcccgacaacgtctccctggaactcggtgcgctcgtcgaacccatgtcggtggcctac
cacgcggcaaccctcggcgacgtgtccgccggcgacaccgcggtggtgttcggcgccggg
cctatcggcatcgggctgtggttcgcgttgcgcggcaagggactcgaatcggtgtacgtc
gccgaaccgtcgccgacccggcgcgccgcgatcgaggcgctcggcgcgacgacgctggat
ccgacgcaggtcgacgtgcccgggttcatcgccgacgtcaccggcgggcgcggggctgat
gcggccttcgacgccgcgggggtggcaccggcgatcgaggccgcgaccgcgagcgtcggt
tcacggcggccgacggtcagcgtcgcgatctacgagaagccgctcaccacaccgctgctg
aacctggtgatgaacgaatcccgtatccagggctcgctgtgctacacatccgccgatttc
gaggccgtgatcgcactgatggccgacggcgtctacgacaccaccggatgggtcaccagg
atcggcatcgacgacgtcgtcgacgaggggttcgaggcgctgcacgcgggccgcaagatg
aaggtgctcgtcgaccccgcggtctga

DBGET integrated database retrieval system