KEGG   Mycolicibacterium goodii: AFA91_22525Help
Entry
AFA91_22525       CDS       T04008                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mgo  Mycolicibacterium goodii
Pathway
mgo00361  Chlorocyclohexane and chlorobenzene degradation
mgo00625  Chloroalkane and chloroalkene degradation
mgo01100  Metabolic pathways
mgo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mgo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AFA91_22525
   00361 Chlorocyclohexane and chlorobenzene degradation
    AFA91_22525
Enzymes [BR:mgo01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     AFA91_22525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AKS34207
UniProt: A0A0K0XA25
Position
complement(4810210..4810905)
Genome map
AA seq 231 aa AA seqDB search
MALRALVFDVFGTLVDWRSGVADAFRSAGTAGDPEELADAWRARYRPILDEVNDGLRPWG
NFDELHLATLQDVLSEREIALPPDQLNSLVQAWHRLDPWPDVRDGLELLRSDFLTAPLSN
GHVRLVVDLARHGDLRFDCILSAELAHAYKPAPQTYLTAAHLLDVDPSEVMLVAAHPSDL
AGARAGGLRTAFIDRPLEHGPATPKRSDRKADVSAGDLHELARLLADAGFN
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggctctacgcgcactggttttcgacgtcttcgggaccctcgtggactggcgctcgggt
gtcgccgacgcattccggtccgccggtacggcgggcgacccggaggaactcgccgacgcg
tggcgggcccggtatcgcccgatcctcgacgaggtcaacgacggtctgcggccatggggc
aacttcgacgagcttcacctggcgacgcttcaggatgtgctcagcgagcgggagattgcg
ttaccgccggatcagttgaactctcttgtgcaggcgtggcaccggctcgacccgtggccg
gatgtccgggatggcctcgaactgttgcgcagtgatttcctcaccgcaccgttgtccaac
gggcacgtgaggctggtcgtcgacctcgcccgccacggcgacctgcggttcgactgcata
ctctcggccgaactggcgcacgcctacaaacccgcaccccagacgtacctgaccgcggca
caccttctcgacgtcgacccctcggaagtgatgctggtcgccgcgcacccgtccgatctc
gcgggcgcccgcgccggcgggctgcgcaccgccttcatcgaccgtcccctggagcacgga
ccggccaccccgaaacggtccgaccgcaaggcggacgtctccgcaggcgacctgcacgag
ctggcgcggctgctcgccgacgcgggtttcaactga

DBGET integrated database retrieval system