KEGG   Mycobacterium gordonae: H0P51_02435
Entry
H0P51_02435       CDS       T06936                                 

Definition
(GenBank) protocatechuate 3,4-dioxygenase
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
mgor  Mycobacterium gordonae
Pathway
mgor00621  Dioxin degradation
mgor01100  Metabolic pathways
mgor01120  Microbial metabolism in diverse environments
mgor01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mgor00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    H0P51_02435
Enzymes [BR:mgor01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     H0P51_02435
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: QLL07875
UniProt: A0A7D6HYI8
Position
550325..551089
AA seq 254 aa
MNSQAHVVLEGFAQLRRSIRALKPDLVILVSSEHGPTLPPSGPQPPFAIAVTDSFWTYGE
MHIPRREVPSNRDFAGEFIRYAGGEGFDIASIGNFRADHGIAIPALMMLPELDVAVVPLI
VGTQSSYSRAAPTRCYQLGRVLARYAASRDQRVIIVGCGGLSHWPGSSQMGRINLDFDRE
FLALMSAGDAGYAASWSNDHIVEHAGNGGLEIRNWLVAAAAVGDPGGEILYYEPIRPWVT
GMGAFAFTSPAHAD
NT seq 765 nt   +upstreamnt  +downstreamnt
gtgaactcccaagcgcacgttgtgctcgagggattcgcacaactccggcggagcatacga
gcactgaaacccgaccttgtgatcctggtgtcgtcagaacacggaccgacactgcccccg
agcgggccgcagccaccattcgcgatcgcggtaaccgactcgttctggacttatggcgaa
atgcacatccctaggcgcgaagtcccgtccaaccgcgatttcgcaggagaatttattcgc
tacgcgggtggcgaaggcttcgacatcgcatcgattggcaactttcgcgcggatcacggt
atagcgattcccgccctgatgatgcttcctgagcttgacgtggcggtggttccgctgatc
gtcggaacacagtcgtcctactcccgcgccgcgccgacccgctgttaccaactcgggcgg
gtcctcgctcgatatgccgcctcgcgagaccagcgagtgatcattgtcgggtgcggtggc
ttgtcccattggcccggcagctctcaaatgggccggatcaacctggatttcgatcgagaa
tttctggcactgatgtcggccggcgatgctggctacgccgcgtcctggtccaacgaccat
attgtcgagcatgcgggaaacgggggacttgagatacgcaattggcttgtcgcggccgct
gctgtgggtgacccgggtggcgaaatcctttactacgaaccgatcagaccgtgggtgacc
ggaatgggtgcgtttgcattcacctcgcctgcccacgccgactag

DBGET integrated database retrieval system