KEGG   Mycobacterium gordonae: H0P51_07750
Entry
H0P51_07750       CDS       T06936                                 

Definition
(GenBank) mycofactocin-coupled SDR family oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mgor  Mycobacterium gordonae
Pathway
mgor00903  Limonene and pinene degradation
mgor01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgor00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    H0P51_07750
Enzymes [BR:mgor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     H0P51_07750
SSDB
Motif
Pfam: adh_short_C2 adh_short KR DUF1776
Other DBs
NCBI-ProteinID: QLL08791
UniProt: A0A7D6HSF6
Position
complement(1735547..1736392)
AA seq 281 aa
MSGNSVGRVAGKVAFITGAARGMGREHAIRLAEEGADVIAVDVCEDIDGVAYPGATETDL
ADTAAFVEKAGRRSFTAKADVRNLDSLRAALEQGVAALGPVDIVVANAGISGSPAPAAQI
EHSAWQTMIDINLTGVWQTVKAALPHMTNGGGSIILVSSMLGIRGGGYMAHYAAAKHAVV
GLMNSLANELAPQWIRVNSIHPGNILTPMLDNEQFCRTLRPDLPNPTVHDAAEIIGQFHL
LPKPLIEARAVSNAVLFLASDEAHYITGAALPVDAGAVAKF
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtcaggcaatagcgtcggcagagtcgccggcaaggtcgcattcatcaccggcgcggca
cgcggtatgggccgtgagcacgcgatccggctggccgaggagggcgccgacgtcatcgcc
gtcgacgtctgcgaggacatcgacggtgttgcctaccccggcgcaaccgagaccgacctg
gccgacaccgcggcgttcgtggagaaggcgggccggcgctcgtttaccgctaaggccgac
gtgcggaatctggacagtctgcgcgccgccctcgaacagggtgttgccgccctgggcccg
gtcgacatcgtggtcgccaacgccgggatcagcggttctcccgcccccgcggcgcagatc
gagcattccgcatggcagacgatgatcgacatcaacctgaccggcgtgtggcaaaccgtc
aaggccgcgttgccgcacatgaccaacggcggtgggtcgatcatcctggtcagctcgatg
ctgggcattcgcggcgggggttacatggcccactacgcggccgcgaaacacgccgtcgta
gggctgatgaactctttggccaatgagcttgcgccgcagtggattcgagtcaactcaatt
cacccgggcaatatcttgacgccgatgctggacaacgagcagttctgccggacactgcgg
cccgacctgcccaatccgaccgtgcacgacgctgcggagatcattgggcagttccacctg
ttgcccaaaccgctgatcgaggcgcgcgccgtgagcaacgcggtgcttttcctggcctcc
gacgaggcgcactacatcacaggggcggccctgcccgttgacgccggggcagtcgcgaaa
ttctga

DBGET integrated database retrieval system