KEGG   Mucilaginibacter gotjawali: MgSA37_01599Help
Entry
MgSA37_01599      CDS       T05131                                 

Gene name
phhA
Definition
(GenBank) Phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
mgot  Mucilaginibacter gotjawali
Pathway
mgot00360  Phenylalanine metabolism
mgot00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mgot00790  Folate biosynthesis
mgot01100  Metabolic pathways
mgot01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgot00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    MgSA37_01599 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MgSA37_01599 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MgSA37_01599 (phhA)
Enzymes [BR:mgot01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     MgSA37_01599 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: BAU53431
UniProt: A0A0X8X0H4
Position
complement(1666072..1667850)
Genome map
AA seq 592 aa AA seqDB search
MSHFNNFNNPQVAALPGHLKQFIVDQHYEHYTPVDHAVWRYVMRQNYSYLKDVAYYPYIP
GLLKAGLTIEKIPSLQEMNDALGKIGWGAVTVDGFIPPAAFMEYQAYRVLVIAADIRQLK
HIEYTPAPDIIHESAGHAPIIADKDYHEYLSYFGSIGAKAMFSAQDFELYEAIRALSILK
EMPDADEAEIKKAEALLAHRQESMGEPSEMSLLSRLHWWTVEYGLIGTLENPKIYGAGLL
SSIGESVSCMKADIKKLPYTIDAVNYTYDITKTQPQLFVTPTFQNLIDVLETFADTMAFR
RGGAYGLQKAIESKNTCTAVYSSGLQLAGTFKSFENDENGDPIYVRTTGPSALAINNKQI
NGHGKDHHKSGYSSPVGRLKGHAEPLENLGHGELCHLGIENGKETTLTFESGITVSGLVN
NILTDNEKTQLITFTGCTVKDKKGKILFDPSWGVYDMAVGEKIVSVFCGAADKDAFEDIT
YKSTSGTYHPAYDVRTLELHKLYQQVRDRRHNGGEYGFLGNVWLRLQKNHHDDWLCALEI
LEILEHEEVEPELANEIRSFLEQKAAAEPEYKKLINDGFYLIKHPVEQKLVV
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagccattttaataattttaataatccgcaggtagctgcgttgcccggccatttaaag
caatttatagtcgatcagcattatgaacactatacaccggttgaccatgctgtgtggcgc
tatgtaatgcgtcaaaactatagttaccttaaggatgtcgcctactatccttacattccc
ggcttgttaaaagccggcttaactatcgaaaagatcccgagcctgcaggaaatgaacgac
gcgctgggtaaaattggctggggtgcagttactgttgacggctttatcccgccggcagct
tttatggaataccaggcttaccgggttttagtaattgccgccgatatccgccagttaaag
catattgaatacacacccgcacctgatattatccatgagtcagcgggccatgcccctatt
atcgcagataaagattatcacgaatacctgagttatttcggttcaattggcgcaaaagcc
atgttttcggcccaggactttgaattgtacgaggccatcagagccctatctattttaaaa
gaaatgcctgatgcggatgaagccgaaataaaaaaggcagaagcgcttttggcccacagg
caggaaagcatgggcgagccttccgaaatgtcacttttaagccgtttacactggtggacg
gttgaatacgggttgatcggtacgctggaaaatccaaaaatatatggtgccggcttgtta
tcgtcaataggtgagagtgtaagttgcatgaaagccgatatcaaaaaattaccgtatacc
attgatgcggtaaattacacttacgatatcaccaaaacccagccccaactatttgtaacc
ccaactttccaaaacctgattgatgtactggaaacatttgcagataccatggccttcagg
cgtggcggcgcttatgggctgcaaaaagcgattgaaagtaaaaacacctgcactgcggtt
tacagttcgggactgcaactggcaggtacttttaaaagttttgaaaatgatgaaaatggt
gatccgatttatgtacggacaaccgggccgtcggctttagcgataaacaacaaacagata
aacggccatgggaaagaccaccataaaagcggctatagttcgcccgttggaaggctaaaa
ggccacgctgagccgcttgagaacctgggccatggtgagctttgtcatcttggaattgaa
aatgggaaagaaaccacattaacttttgagagtggtataaccgttagcggcctggtaaat
aacatccttacggacaatgaaaaaacgcaactgattacctttaccggttgcacggtaaaa
gataaaaaaggtaaaatacttttcgacccatcatggggtgtttatgatatggcagtgggc
gaaaagatcgtttcggttttttgcggtgccgcagataaggatgcatttgaagatattact
tataaatcaacttcgggcacttaccacccggcttacgatgtccgtacattagagctgcac
aaactctaccagcaggtgcgggatcgcaggcacaatggcggcgaatatggctttttaggg
aatgtttggctgcgtctgcaaaaaaaccatcatgacgactggctttgcgctttagaaata
ctggagatattggagcatgaagaagttgaacctgaattggcaaacgagatcaggagtttt
ttggagcaaaaagctgctgctgagcctgaatataaaaaactgatcaatgatggattttat
ctgataaaacaccctgttgagcaaaaattggtagtttag

DBGET integrated database retrieval system