KEGG   Mucilaginibacter gotjawali: MgSA37_03664Help
Entry
MgSA37_03664      CDS       T05131                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mgot  Mucilaginibacter gotjawali
Pathway
mgot00020  Citrate cycle (TCA cycle)
mgot00480  Glutathione metabolism
mgot01100  Metabolic pathways
mgot01110  Biosynthesis of secondary metabolites
mgot01120  Microbial metabolism in diverse environments
mgot01130  Biosynthesis of antibiotics
mgot01200  Carbon metabolism
mgot01210  2-Oxocarboxylic acid metabolism
mgot01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MgSA37_03664 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MgSA37_03664 (icd)
Enzymes [BR:mgot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MgSA37_03664 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAU55475
UniProt: A0A0X8X4I9
Position
complement(4029979..4031208)
Genome map
AA seq 409 aa AA seqDB search
MSKIKVENPVVELDGDEMTRIIWKFIKDKLIFPYLDLDIKYYDLGIEYRDETNDQVTVDA
ANAILKYGVGIKCATITPDEARVTEFGLKQMWKSPNGTIRNILDGTVFREPIVMANVPRL
VPNWTAPICIGRHAFGDQYRATDFVTKGKGKLTITYTPEDGSAEQSFEVYNFKGDGVAMA
MYNTDESIKGFARACFNQALLKKWPLYLSTKNTILKKYDGRFKDIFEEIYQNEFKIEFEA
NQLTYEHRLIDDMVASALKWHGNFVWACKNYDGDVQSDTVAQGFGSLGLMTSTLVTPDGT
VMEAEAAHGTVTRHYRDHQAGKPTSTNPIASIFAWTRGLEFRGLLDNNQELIKFCKALEE
VCIETVESGKMTKDLAITIKPKVEHGTDYLYTEEFLAAIDENLKKKLGK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattaaagtagaaaatccggtagttgaactggatggcgatgaaatgacccgg
atcatctggaaattcatcaaagacaaattaatctttccgtatctcgatcttgatattaaa
tattatgaccttggaattgagtatcgcgatgaaaccaacgaccaggtaaccgttgatgcc
gccaacgctattttaaaatacggcgtaggcattaaatgcgccactattacccccgacgaa
gcgcgtgtaacggaatttggtttgaaacaaatgtggaaatcgccaaacggcacaatccgt
aacattttggatggtactgtttttcgtgagcccattgtaatggctaatgttccgcggttg
gtacccaactggactgcgcctatctgtatcggccgtcacgcttttggcgaccagtaccgt
gcaactgattttgtgaccaaagggaaaggtaaattaaccatcacttacacgcctgaagat
ggcagtgccgaacaatcatttgaagtgtacaactttaagggtgatggcgtggctatggcg
atgtacaatactgatgaatctatcaaaggttttgcccgtgcttgttttaaccaggctttg
ctaaaaaaatggcctttatacctgtctaccaaaaacaccatccttaaaaaatacgatggc
cgttttaaagatatttttgaagaaatttatcagaatgaatttaaaattgagtttgaagcc
aaccagttaacttacgaacaccgtttgattgatgacatggtagcttctgcccttaaatgg
catggcaattttgtttgggcctgtaaaaattatgatggcgacgtgcaatcagataccgtt
gcacagggttttggttcgttaggtttaatgacctcaactttggttacccctgacggaacc
gttatggaagctgaggctgcacacggtacagtgacccgccactaccgcgaccaccaggct
ggcaagccaacttcaaccaaccccatcgcttcaatttttgcatggacccgtggtttggaa
ttccgtggcttactggacaacaaccaggagctgatcaaattctgcaaggcactggaagaa
gtttgtattgaaactgttgaaagcggcaaaatgaccaaagatctggccatcaccatcaaa
ccaaaagttgaacacggtaccgattatttgtataccgaagagtttttggctgcgatagat
gagaatttgaaaaagaaattgggtaaataa

DBGET integrated database retrieval system