KEGG   Meleagris gallopavo (turkey): 100538462Help
Entry
100538462         CDS       T01523                                 

Gene name
TYR
Definition
(RefSeq) tyrosinase
  KO
K00505  tyrosinase [EC:1.14.18.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00350  Tyrosine metabolism
mgp01100  Metabolic pathways
mgp04916  Melanogenesis
Module
mgp_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100538462 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100538462 (TYR)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     100538462 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tyrosinase Laminin_EGF
Motif
Other DBs
NCBI-GeneID: 100538462
NCBI-ProteinID: XP_003203582
Ensembl: ENSMGAG00000015220
Position
1
AA seq 537 aa AA seqDB search
MLSCRSVRMSLFAMCLLLAILQPSAGQFPRVCANTQSLLRKECCPPWDGDGSPCGERSNR
GTCQRILLSQAPLGPQFPFSGVDDREDWPSVFYNRTCRCRGNFMGFNCGECKFGFSGQNC
TERRLRTRRNIFQLTVSEKDKFLAYLNLAKNIPSKDYVIATGTYAQMNNGSNPMFRNINV
YDLFVWMHYYASRDTLLGGSNVWRDIDFAHEAPGFLPWHRAFLLLWEREIQKITGDENFT
IPYWDWRDAEDCVICTNEYMGGQHPTNPNLLSPASFFSSWQVICTRSEEYNSQQALCNAT
SEGPILRNPGNNDKSRTPRLPSSSEVEFCLSLTQYESGSMDKMANYSFRNTLEGFADPRT
AISNISQSGLHNALHIYMNGSMSQVQGSANDPIFILHHAFVDSIFERWLRRHRPMLEAYP
AANAPIGHNRENYMVPFIPLYRNGEFFIPSRELGYDYEYLQEPALGSFQDFLIPYLEQAR
QLWPWLVGAAVIGGVVTAVLSGLILACRKKRAGTSPEIQPLLTESEDYNNISYQSHF
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgctctcctgccgctctgtgaggatgtctctgtttgccatgtgcttactgctggccatc
cttcagccgtccgctgggcagttccccagagtctgtgcgaacacacaaagcttgctgagg
aaggagtgctgtcctccctgggatggcgatgggtccccttgcggggagcgttccaacaga
ggaacctgccagcgcatccttctctctcaggctcctctgggaccacagttccctttctca
ggagtggatgacagagaggattggccttctgtgttttacaaccggacatgcagatgcaga
ggcaatttcatggggttcaactgtggggagtgcaagtttggcttctcgggacaaaactgc
actgaaaggcgactcagaacgagaagaaacatcttccagctcaccgtcagtgagaaggac
aagttccttgcctaccttaacctagcaaagaatatccctagcaaggactatgtcattgct
actggcacatacgctcagatgaacaacggctccaatcccatgttcagaaatatcaacgtg
tatgatctcttcgtctggatgcattattatgcctctcgagacacacttttaggtggctcc
aatgtgtggagggacattgattttgcccatgaagctcctggttttctgccttggcatcgt
gcttttctgctgctgtgggaacgtgagatacagaagataacaggtgatgagaacttcacc
atcccctactgggactggcgagatgcagaggactgtgtgatctgcactaatgaatacatg
ggtggccaacaccccaccaaccctaatttactcagcccagcatcatttttctcctcgtgg
caggtaatctgcactcgatctgaagagtacaacagccagcaggctttatgcaatgccact
agtgaagggcctatacttcgaaatcctggaaacaatgacaaatcaaggaccccaaggctc
ccatcttcatcagaagtcgaattttgtctgtcactcactcagtatgaatctggatccatg
gataaaatggccaattatagcttccgaaacactttggaaggctttgctgatccacgcact
gcaatatcaaacatatctcaaagtggtttgcataatgcccttcacatctacatgaatggc
tccatgtcccaagtacaaggctctgcaaatgatcctatcttcatcctacaccatgctttt
gttgacagcatttttgagcgatggttaagaagacacagacccatgctagaagcttaccca
gcagccaatgcacccattgggcacaatcgagaaaattatatggttccctttatccctctc
tacagaaatggagaattttttataccatcaagggagctggggtatgactatgagtatctg
caagaaccagcacttggttctttccaggactttttaatcccctatcttgagcaagcccgt
cagctctggccctggctggttggcgcagctgtgatcggaggcgtagttactgctgtgctc
tctgggctcatcctggcctgcaggaagaaaagagcaggaacttctccagaaatacaaccc
ttactcacagaaagtgaggattacaacaatatatcttatcaatcccatttctga

DBGET integrated database retrieval system