KEGG   Meleagris gallopavo (turkey): 100539236
Entry
100539236         CDS       T01523                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mgp03021]
    100539236 (AFF3)
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100539236 (AFF3)
SSDB
Motif
Pfam: AF-4_C DUF908
Other DBs
NCBI-GeneID: 100539236
NCBI-ProteinID: XP_010715104
Position
1
AA seq 251 aa
MPRNADYFMQEAKRKKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMY
SETVELIRYAVRLKTHSGPSATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIE
YFKNSSKAAQNPSSWGNSGKSTGTPSPMSPSPSPVSSVGSQGSTGPPSSSPIISIPQRIH
QMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDALMGPITLHSSMEHLVQYTQQG
LHWVRNSTHLS
NT seq 756 nt   +upstreamnt  +downstreamnt
atgccacgcaatgcagattactttatgcaggaagctaaacggaagaaacataaagcagat
gcgatggtggaaaagtttggaaaggcactgaattatgcagaagcagcactatcgtttatt
gagtgtggaaatgcaatggaacaaggcccaatggaatctaaatccccctatacaatgtat
tcagaaacagttgaactcatcaggtacgccgtgagactaaaaacccactcaggccccagc
gccacgccagaagacaagcagttggcagcactatgttaccgctgcctggcccttctgtac
tggaggatgttccgactcaagagagaccatgctgtcaagtattctaaagcacttattgag
tatttcaagaattcatcaaaagccgcccagaacccatcttcttggggtaacagtggaaag
agcacaggaactccatcgcccatgtcccctagcccttctccagtcagttctgtcggatcc
caggggagcacagggcccccttcttcatctcctataatcagcatcccccagcgcatccat
cagatggccgccaaccacgtcagcatcaccaacagcatcctgcacagctatgactactgg
gagatggctgacaacctggccaaggaaaatagagaattttttaacgacttggatgcattg
atgggacctatcaccttgcacagcagtatggagcatttagttcagtacactcaacaagga
cttcactgggtgcggaatagcactcacttgtcataa

DBGET integrated database retrieval system