KEGG   Meleagris gallopavo (turkey): 100539320Help
Entry
100539320         CDS       T01523                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00600  Sphingolipid metabolism
mgp01100  Metabolic pathways
mgp04020  Calcium signaling pathway
mgp04370  VEGF signaling pathway
mgp04371  Apelin signaling pathway
Module
mgp_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100539320 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100539320 (SPHK1)
   04371 Apelin signaling pathway
    100539320 (SPHK1)
   04020 Calcium signaling pathway
    100539320 (SPHK1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100539320 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 100539320
NCBI-ProteinID: XP_010719721
Position
20
AA seq 506 aa AA seqDB search
MAAGRRVPPQDDGGAVLLRGRFSPGPSPGLVSCSVALTERELQVLRPGGPDAALRLADCV
GSAAFPSGPGAACFSLVGYPFRKARWGSPARQRLQRTFRVSQHPDAEENLRIAQAWSQRI
RELSLPAAPTRDGASYGVLPRPCRALVLLNPQSGAGRALEDFQAVVQPMLADADITPTVF
VTERPHHAQEKVQDEDLSQWDVLVVMSGDGLLHEVLNGLMERPDWEQALQTPLCILPGGS
GNALAASINYYAGNDHVAKKKLLTNCTFILCKGLHAPMDLVSLSTASGKRFFSFLGFGWG
FIADVDIDSEKYRRLGNARFTLGTLQCLVRLRIYQGRLSYLPAAAEPGSPRDPKTRRAAP
TAGTKALTGDGEPPADTLLVPLGQPVPPHWVVVPEEEFVCVYAIYQSHLGTNLLMAPAAR
LHDGCIHLFYVRAGISRVALLKIFLAMGRGTHLELNCPHLHCVPVRAFRLEPRGSAGVMT
VDGEALACEPVQGQIHGRMCRVVTGS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggccgccggccgccgggttcccccgcaagacgacggcggtgcggtgctgttgcggggc
cgcttctccccgggaccgtctcccggtttggtttcgtgttccgtcgctctgaccgaacgg
gagctgcaggtgctgcgtcccggcggtcccgacgcggctctccgtttggccgattgcgtg
ggtagcgccgcgttcccgtccggccccggcgccgcctgcttctccctcgtgggttacccg
ttccgtaaggcccgatggggttcccccgcccggcagcgcctgcagaggactttccgcgtt
tcccaacaccccgacgccgaagagaatctccgcatcgcccaggcctggagccaacgcatc
cgagagctctcgctgcccgcagcgcccacgcgggacggtgccagctatggggtgctgccc
cggccctgcagagctctggtgctgctgaacccgcagagcggagctggccgcgcgcttgag
gatttccaggcagtggtgcagcccatgctggctgatgctgacatcacacccaccgtcttt
gtcactgagagaccccaccacgcccaggagaaggtgcaggatgaagacctgtcgcagtgg
gatgtgctggtggtgatgtctggggatggtctgctccacgaggtgctgaatgggctgatg
gagcggccggactgggagcaggccctgcagacaccgctgtgcatcctgcctgggggctct
gggaacgccttggctgcctccatcaactactatgcaggcaacgaccacgtggccaagaag
aaactgctgaccaactgcaccttcatcctgtgcaaggggctgcacgctccgatggacctg
gtctcattgagcacggcctcgggcaaacgcttcttctccttcctgggcttcggatggggt
ttcatcgccgacgtggacattgacagtgagaagtaccggcggctgggcaacgcacgcttc
acgctgggcacgctgcagtgcttggtacgcctgcgcatctaccagggccgcctctcctac
ctgcctgcagccgccgagccgggcagccccagggaccccaagacccgccgggccgcacca
acagcggggacgaaggcactgactggggacggggagccgcccgctgacacgctgctggtg
ccgctggggcagccggtgccgccgcattgggtcgtggtgcccgaggaggaattcgtctgc
gtctacgccatctaccagtcccacctgggcaccaacctgctgatggctccggcggcgcgg
ctgcacgacggctgcatccacctcttctacgtgagggcgggcatcagccgcgtggcgctg
ctgaaaatcttcctggccatgggcagaggcacgcatctggagctgaactgcccccacctg
cactgcgtcccggtgcgcgccttccgcctggagccgcggggcagcgccggcgtcatgacg
gtggacggggaggcgttggcgtgcgagcccgtgcaggggcagatccacggccgcatgtgc
cgcgtggtcaccggctcctag

DBGET integrated database retrieval system