KEGG   Meleagris gallopavo (turkey): 100539332Help
Entry
100539332         CDS       T01523                                 

Definition
(RefSeq) nucleoside diphosphate kinase 6-like
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00230  Purine metabolism
mgp00240  Pyrimidine metabolism
mgp00983  Drug metabolism - other enzymes
mgp01100  Metabolic pathways
Module
mgp_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mgp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mgp_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100539332
   00240 Pyrimidine metabolism
    100539332
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100539332
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100539332
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     100539332
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100539332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 100539332
NCBI-ProteinID: XP_010724588
Position
1
AA seq 175 aa AA seqDB search
LGTPWRCAPPAQPLRLCPQAVHETILSNRLLIVRAKELRCGREQSRRFYREHAGRFFYQR
LVEFMASGPMWAYILAHENAISLWRSLMGPTKVFRARNCVPDSIRGAYGLTDTRNTTHGS
DSPASASREIAFFFPEFNEQLWYQQEEPRLRCGQMYYNAEKRVHCVIRGEETELT
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
ctcgggacgccctggcggtgcgcgcctcccgcccagccgctgcgcctctgcccacaggcc
gtgcatgagaccatcctcagcaaccgcctcctcatcgtgcgcgccaaggagctgcgctgc
gggcgggagcagagccgccgcttttaccgggagcacgcggggcgattcttctaccagcgg
ctggtggagttcatggccagtggccccatgtgggcttatatcttggcccatgagaatgcc
atctccctctggagatcactgatgggacccaccaaagtgttccgagctcgaaattgtgtc
ccagactccatccgaggagcttatggcctcactgacaccaggaataccacccatggttca
gattccccagcgtcagccagcagggaaattgccttcttcttcccagagttcaatgaacag
ctctggtaccagcaggaggagccacgtctgcgctgtgggcagatgtattacaatgcagag
aagcgtgtccactgtgtgatcaggggtgaagaaacagagttgacatga

DBGET integrated database retrieval system