KEGG   Meleagris gallopavo (turkey): 100539446Help
Entry
100539446         CDS       T01523                                 

Gene name
ROCK1
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04270  Vascular smooth muscle contraction
mgp04350  TGF-beta signaling pathway
mgp04510  Focal adhesion
mgp04530  Tight junction
mgp04810  Regulation of actin cytoskeleton
mgp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100539446 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100539446 (ROCK1)
   04530 Tight junction
    100539446 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100539446 (ROCK1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100539446 (ROCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100539446 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100539446 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgp03036]
    100539446 (ROCK1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100539446 (ROCK1)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   100539446 (ROCK1)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100539446 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH FPP C1_1 APH Pkinase_C
Motif
Other DBs
NCBI-GeneID: 100539446
NCBI-ProteinID: XP_010707117
Ensembl: ENSMGAG00000009863
Position
3
AA seq 1385 aa AA seqDB search
MSTGESFESRFEKIDGTLKDPKSEVNVDCLLDGLDALVYELDFPALRKNKNIDNFLNRYK
DTVNKMRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSSRRVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNEISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKDDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDIDEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSVSAENSNDNRTGS
SMDKSVMENMQKMIYDLEEQLHNEMQLKDEMEQKCRSSNITLDKIMKELDEEGNQRKNLE
LTVSQIEKEKMALQHKINDYQRKIEQESEKRRNVENEVSTLKDQMEDLKKISQHSQITNE
KITQLQKQLEEANDLLRTESETAVRLRKGNTEMSKSLSQVESLNRELQERCRVLESAKLQ
VEKDYYQLQAALESERRDRSHGSEMIGELQVRITTLQEELKNLKNNLERVEAERKQAQDR
LNHSEKEKNNLEIDLNYKLKSLQDRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCGKNG
KKVKEERAAREKAENRIVQAEKQCSMLDFDLKQSQQKLEHLLQQKERLEDEVKNLSLQLE
QETNKRIMAQNELKAQAFEADNLKGSEKQLKQEINTLLEAKRLLEVELAQLAKQYRGNEG
QMRELQDQLEAEQYFSTLYKTQVKELKEEIDEKNKETQRKMQELQNEKETLTTQLDLAET
KAESEQLARALLEEQYFELSQESKKAASRHRQEMTDKDSIIRRLEETNSTLTKDVDLITK
ENSEISEKMKKQEEEYKMKKEEEINNIRMQYEKSINTERTLKTQAVNKLAEIMNRKDFKI
DRKKASMQDLRKKDKENRKLQLELNQEKEKFNQMVVKYQKELNEMQAQLAEESTYRNELQ
MQLDSKESDIEQLRRKILDLQQGMDSTSVSSLQPDEIDGNLSESRLEGWLSIPNKGNIKR
HGWKKQYVVVSSKKILFYNDEKDKDQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKI
FQILYANEGECRKDVEVESVQPAEKTNFLNHKGHEFIPTIYHFPANCEACAKPLWHVFKP
PAALECRRCHVKCHRDHLDKKEELIAPCKVSYDVTSARDMLLLASCQDEQKKWVTHLVKK
IPKNPPSTFVRASPRTMSTRSSANQSFRKAVKNTSGKTRHQVWRKRNIEHKQFREAQLLA
SKSAS
NT seq 4158 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgggagaaagttttgagtctcggtttgaaaaaatcgacgggactttaaaggat
cccaaatccgaagtgaacgtggactgtttgctggatggattagatgctttggtgtatgaa
ttggattttcctgccttgcgaaaaaacaaaaacattgataacttcttaaacaggtataaa
gacacagtaaataaaatgagggatctgcggatgaaagctgaagattatgaagtggtgaag
gtcattggcagaggggcatttggggaagttcagttggtaaggcataaatcatcaagaaga
gtgtatgctatgaaacttctaagcaaattcgagatgataaaaagatcagattctgcgttc
ttctgggaagaaagggatattatggcttttgctaatagtccctgggttgttcagttattt
tacgcattccaagatgatcgttatctttacatggtcatggaatacatgcctggtggagac
cttgtaaatttaatgagtaactatgatgttcctgagaaatgggcaagattttatactgct
gaagttgttcttgcattagatgcgattcactcaatgggctttatacacagagatgtgaag
cctgataatatgctgctagataaagctggtcatttaaaactagcagattttggtacttgt
atgaaaatgaacaaggaaggtatggtacgatgtgatacagctgtaggaacaccagactat
atctctcctgaagtactgaagtcccagggtggtgacggttactatggacgagaatgtgac
tggtggtcagttggagtttttttgtatgagatgcttgtaggtgacacacctttttatgca
gattctttggttggaacatacagtaagattatgaaccacaagaactcccttaccttccct
gatgacaatgagatctctaaagaggcaaaaaaccttatttgtgcctttttaactgatagg
gaagtgagactgggacgaaatggcgtagaagaaattaaacgacatcttttcttcaaagat
gatcaatgggcttgggagactctcagagatactgtagcaccagttgtgcccgacttaagc
agtgacatagacactagtaattttgatgatattgatgaagacaaaggagaggaagaaaca
tttcccattccaaaagcgtttgtgggcaaccagcttccttttgttggatttacatattac
agcaaccgtcggtatttatctgtctctgcagaaaattccaatgataacagaacaggctcc
agtatggataaaagtgtgatggaaaatatgcagaagatgatctatgatttggaagagcag
ctacataatgaaatgcagctgaaagatgaaatggagcaaaagtgcaggtcttcaaacata
acgctagacaagataatgaaagaactggatgaagagggaaatcaaagaaagaacctggaa
ctaacagtgtcccagattgagaaggaaaagatggcactgcagcataagataaacgactac
caaagaaaaattgaacaagagagtgaaaagagacggaatgtggaaaatgaagtgtctacg
ctaaaagatcaaatggaagacttgaaaaaaatcagccagcattcacaaattacaaacgag
aagataacacagttacaaaaacaactagaagaagccaatgatttgctacggacagaatca
gaaacagcagtaagactgagaaagggtaacacagaaatgagcaagtcattgagtcaagta
gaatcactgaatagagaactgcaggaaaggtgtagagttctagaaagcgcaaaactgcag
gtggagaaagactattatcaactgcaagcagctttggaatcggaacgaagggacagaagt
catggatctgaaatgattggagaactacaggttcggattacaactttacaagaagaatta
aaaaaccttaaaaataatcttgaaagagtggaagcagaaagaaaacaagctcaagatagg
cttaatcattcagaaaaggaaaagaataatttggagatagatttgaactacaaactcaag
tctttacaagaccgcttagaacaggaagtaaatgaacacaaagtgactaaagctcgatta
actgacaaacatcagtcaatagaagaggcaaaatcagttgcaatgtgcggtaaaaatgga
aaaaaagtaaaggaagaaagagcagcaagagaaaaggcagagaatcgaatagttcaggct
gaaaaacagtgttccatgctagactttgacctgaagcagtctcagcagaaattggaacac
cttcttcagcaaaaggaaagactggaggatgaagtaaagaatctgtcacttcagctagag
caagagacaaataagcgaataatggcacagaatgaattaaaggcgcaagcttttgaagca
gataacttgaagggttctgagaagcaactgaaacaagaaatcaatacgttattggaagca
aaaagattactggaagttgagttggctcaacttgctaaacagtacagaggaaatgaaggt
caaatgcgtgagcttcaggatcagcttgaagcagagcaatatttttcgacactttacaaa
actcaggttaaggaactgaaggaagaaattgatgaaaagaataaagaaacgcaaagaaaa
atgcaggaattgcaaaatgagaaagaaacactcactacgcagctggatttagctgaaacc
aaagctgagtcggaacagttggcacgggcacttcttgaagagcagtattttgaattgagt
caggagagcaaaaaagcagcatcacgacataggcaagaaatgacagataaggacagcatc
ataagaaggctggaagaaactaacagcacattaaccaaagatgttgatctaataacaaaa
gaaaattcagagatcagtgaaaaaatgaagaaacaggaggaagaatataagatgaaaaaa
gaggaagaaattaacaatattagaatgcaatatgagaagagtatcaacacagagagaact
ctgaagacacaggctgtcaacaaactggctgagatcatgaatagaaaagattttaaaata
gatagaaagaaagcaagcatgcaagatttgaggaagaaagacaaggaaaaccgaaagcta
caactggagcttaatcaagaaaaagagaaattcaatcagatggtagtgaaataccagaag
gagcttaatgaaatgcaagcgcaactagcagaagaatcaacatacaggaatgagctacag
atgcaactggatagtaaagagagtgacatagaacaactacgaaggaaaattttggatctc
cagcaaggaatggattccaccagcgtttctagtttacagccagatgaaattgatgggaat
ctttcagaatcaaggcttgaaggttggctttcaataccaaacaagggaaacataaagcga
cacggctggaagaaacagtacgttgtggtgagcagtaaaaagatactgttctataatgat
gaaaaggacaaggaccagtctaatccatccatggtactagacatagataagctgttccat
gtccgacctgtaactcaaggagatgtatatagagcagaaactgaagaaattcctaaaata
ttccagattttgtatgctaatgagggggaatgcaggaaggatgtggaggtagagtcagtc
cagcctgcagagaagacaaacttcctaaatcataaaggccatgaatttattccaacaata
taccactttccagccaactgcgaggcctgtgccaaacctctttggcatgtcttcaagccc
ccagctgccctggaatgtcgaagatgccatgtgaagtgccatagagaccacttggataaa
aaggaggagttaattgcaccgtgcaaagtgagttacgacgtaacttcagcaagagatatg
ttgttgctggcatcctgtcaagatgaacagaagaaatgggtaactcatttagtaaagaag
atccctaagaacccaccttctactttcgttcgtgcttctcctagaaccatgtctacaaga
tcctcagcaaaccagtcattccgaaaagctgttaaaaatacttctggaaaaacgaggcat
caagtatggaggaagaggaatattgagcataagcaatttagagaggcacagctgttggcc
agcaagagtgctagctaa

DBGET integrated database retrieval system