KEGG   Meleagris gallopavo (turkey): 100540109Help
Entry
100540109         CDS       T01523                                 

Gene name
XPO5
Definition
(RefSeq) exportin 5
  KO
K14289  exportin-5
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100540109 (XPO5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mgp03016]
    100540109 (XPO5)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100540109 (XPO5)
Transfer RNA biogenesis [BR:mgp03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    100540109 (XPO5)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     100540109 (XPO5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1
Motif
Other DBs
NCBI-GeneID: 100540109
NCBI-ProteinID: XP_010705193
Ensembl: ENSMGAG00000010938
Position
2
AA seq 1133 aa AA seqDB search
MPRLEKVYLKNNVMGLISSGTQSILEEESHIKDVLSRIVVEMIKREWPQHWPDMLKELDT
LSKQGETQTELVMFILLRLAEDVVTFQTLPTQRRRDIQQTLTQNMEKIFSFLLTTLQQNV
NKYRRMVGAPQEQEALTTPQKTDLAQQPKAQANCRVGIAALNTLAGYIDWVALSHITADN
CKLLEMLCLLLNEPELQIGAAECLLIAVSRKGKLEDRKPLMVLFGDVAMHYILSAAQTAD
GEGLVEKHYVFLKRLCQVLCALGSQLCALLGSDSEVETPTNFGKYLDSFLAFTTHPSQFL
RSSTQITWGALFRHEVLSRDPLLLAMIPKYLRASMTNLVKVGFPSKTDSPSCEYSRFDFD
SDEDFNAFFNSFRAQQGEVMRMACRLDSRTGFQMAGEWLKYQLTAPVDTGPMNSKTGEGL
CSIFSPSFVQWDAMTFFSESVISQMFRTLDKDEIPVNDGIDLLQLVLNFETKDPLILSCV
LTNVSALFPFVTYRPEYLPQVLSKLFASVTFEVVEESKAPRTRAVKNVRRHACSSIIKMC
RDYPQLVLPNFEMLYNHVKQLLSNELLLTQMEKCALMEALVLISNQFKDYERQKAFLEEL
MAPVAGLWLSAEMQRVLSDPEAFVSYVGADNKIADPVMEDPSGLNRSRISFCVYTILGVV
KRARWPAAMEEAKAGGFLVGYLPSGSPIYRNPCTEQVLKLFDNLLALIRTHNNLYMPEMV
AKLGETFAKALDMLEVEKNAILGLPQPLLELYDSPVYKTVLERMQGFFCTLYDNCFHILG
NAGPSMQQDFYTVEGLASQLISSAFINLNNIPDYRLRPMLRVFVKPMVLSCPPEYYETLV
CPMLGPLFTYLHMRLSQKWEVINQRSILCEDDAADDNPESQEMLEEQLVRLLTREVMDLI
TVCCVAKRGAEHNSSVAVDGDDDEAMATDVTPPASAELTELGKCLMKQEDVCTALMITAY
ASLSWKDTLSCQRTTTQLCWPLLKQVLPGNLLPDAVSWFFTSVLKGLQIHGQHDGCMAAL
VHLAFQIYEALRPRYAELKVVMEQIPDIQRDSLEQFDSKLLNPTLQKVADKRRKDHFKRL
ITGCIGKPLGEQFRKEVHIRNLPSLFKKVKPSLETDVLETNEDGEDLTVLFEP
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtttggagaaggtttacctaaagaataatgtcatgggtcttatatccagtgga
actcagagcatcctagaggaggaaagtcacattaaggatgttctgtctcgcattgtggtg
gagatgatcaagcgtgaatggcctcagcactggcctgatatgctgaaggagctggatact
ctctccaagcaaggggaaactcagacggaactggtgatgttcatcctcctacgtttggca
gaggatgtggtgactttccaaaccctgcctacccagcggcggcgagatatccagcaaacc
cttacccagaatatggagaagatctttagcttcttactaactaccctgcagcagaacgtc
aacaagtacaggcgcatggttggagcaccccaggaacaagaagccctcaccactccacag
aagactgatctggctcagcagccaaaggcccaagcaaattgccgtgtggggatagcagca
ctcaacaccctggctggctacattgactgggtggccctgagccacatcacagcggacaac
tgcaagctcttggagatgttgtgtctgctcctgaatgagcctgagctccaaataggagca
gcagagtgtctcctaattgctgtcagcagaaaagggaagctggaggatcggaaacctctg
atggtcttgtttggagacgttgccatgcactacattctctctgctgcccagacagcagat
ggtgaaggcctggtggagaagcactatgttttcttgaagagactttgccaagtattgtgt
gcactgggcagccagctgtgtgcgttgctaggttcagattctgaagtggaaacacccacc
aactttggaaaataccttgactcatttttagccttcacaactcaccccagccagtttctg
cgatcttccacccagattacatggggagccctatttcggcatgaggttctgtctcgcgac
cccttgttgctggctatgatccccaagtatcttcgtgcatctatgaccaaccttgtgaag
gtgggctttccctctaaaacagacagccccagttgtgaatactctcgttttgatttcgac
agtgatgaggacttcaatgccttcttcaactctttcagagcccagcaaggagaagtgatg
aggatggcttgtcgtctggactctcgaactggcttccaaatggctggggaatggctaaag
taccagctcacagctcctgttgatactggacccatgaactcgaagacaggcgaaggtctc
tgctccatcttctctccatcctttgtgcagtgggatgccatgaccttcttctcagagagt
gtcatcagccagatgtttcggaccctggataaagatgaaatcccagtgaatgatggcata
gatctactgcagcttgtccttaattttgaaacaaaggatcctctcatcttgtcctgtgtg
ctcaccaatgtctctgctctattcccatttgtcacttaccgaccagaatacctcccacaa
gtactttccaagttgtttgcttcagttacctttgaagttgtagaagaaagtaaggctcct
agaactcgagcagtgaaaaatgtgagaaggcatgcatgctcctctatcataaagatgtgt
cgggattaccctcagcttgtgctgcccaacttcgagatgttgtacaaccatgtgaagcaa
ctgctctccaatgagctacttctgacacagatggagaagtgtgcccttatggaggcactt
gtccttatcagcaaccagttcaaggactacgagcggcagaaagctttcctggaggagctc
atggcccctgttgctggtttatggctctccgcagagatgcagagagttctctcagatcct
gaagcctttgtctcctatgtgggtgcagacaacaaaattgctgatccagtcatggaagat
cctagtggcctgaaccgctctagaataagcttttgtgtgtacaccattctgggagttgtg
aaacgagctcgctggcctgcagctatggaagaggcaaaagctggaggattcctggttggg
tacttgcccagtggaagtccgatctatcgcaatccctgtactgagcaagtcctgaagctt
tttgacaacttacttgctcttataaggactcacaacaatctctacatgccagaaatggtg
gctaagctgggggaaacatttgcaaaagccctagacatgctggaggtagagaagaacgcc
atcctaggtctccctcagcctctactggagctttatgactctcctgtttacaaaacagtc
ttagaaaggatgcagggtttcttttgtaccctctacgataactgtttccacatactgggg
aatgcaggcccatccatgcagcaggatttctacacggttgagggtcttgcctcccagctc
atcagctcagctttcatcaacctgaacaacattcctgattacagattgcgtcctatgctc
cgtgtgtttgtgaagcccatggtactctcctgccctccagaatactacgaaacccttgtc
tgccccatgctgggaccactctttacctatctgcacatgaggttgtctcagaaatgggaa
gtgatcaaccagcgaagcattctctgtgaggatgatgctgcagatgacaaccctgagtct
caggagatgcttgaggagcagttggtcagactgctgacccgagaagtcatggatctcatc
actgtttgctgtgttgctaagagaggtgctgagcataactcttctgttgctgtggacgga
gatgatgatgaagcaatggccacggatgtgactcctcctgccagcgcagagctgacagag
cttggaaagtgtctgatgaagcaggaggatgtttgcactgctttgatgatcactgcctat
gcatccctctcctggaaagacaccttgtcctgccaaagaaccacaacacagctttgctgg
ccgctgctcaaacaggtgcttccaggcaatttgctgcccgatgctgtgtcctggtttttc
accagtgtgctgaagggcttacagatccacgggcagcacgatggctgcatggcagctctc
gtccatctggctttccagatctacgaggccttgcgtcctcgctatgctgagctgaaggtg
gtgatggagcagatcccagatatccagagggactcgttggagcagtttgattcaaagctt
cttaacccaacgctgcagaaagtggcagacaagcgccggaaagatcatttcaaacgcctc
ataacgggttgcattgggaagccacttggagagcagttccgcaaggaggttcatatccgg
aacctcccatctctcttcaaaaaggtgaagccatcgctggagacagatgtgctggagaca
aatgaggatggagaggatctcactgtgctctttgagccctga

DBGET integrated database retrieval system