KEGG   Meleagris gallopavo (turkey): 100540230Help
Entry
100540230         CDS       T01523                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04012  ErbB signaling pathway
mgp04068  FoxO signaling pathway
mgp04150  mTOR signaling pathway
mgp04510  Focal adhesion
mgp04540  Gap junction
mgp04810  Regulation of actin cytoskeleton
mgp04910  Insulin signaling pathway
mgp04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100540230 (SOS2)
   04012 ErbB signaling pathway
    100540230 (SOS2)
   04068 FoxO signaling pathway
    100540230 (SOS2)
   04150 mTOR signaling pathway
    100540230 (SOS2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100540230 (SOS2)
   04540 Gap junction
    100540230 (SOS2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100540230 (SOS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100540230 (SOS2)
   04912 GnRH signaling pathway
    100540230 (SOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone IQ_SEC7_PH PH_13 PH_10 PH_9
Motif
Other DBs
NCBI-GeneID: 100540230
NCBI-ProteinID: XP_003206888
Ensembl: ENSMGAG00000013729
UniProt: G1NLU3
Position
5
AA seq 1330 aa AA seqDB search
MQPPPQPYEFFGEENGPKWRGLFVPALRKVQQQVHPNLSAKEDSLYYIEELILQLLNKLC
IAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHFEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRNEIAEERQYLRELNLIIKVFREAFLSNRKLFTPNDI
DVVFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPQFHEHFNNLMAKPAVALHFQSTAEGFKEAVRYVLPRLMLIPVYHCLHYFELLQQLQE
CSEDEEDRECLKQAITALLNLQCSMERIYSKHSPRRRPGEPVCRFYNRQIRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGTLTKIGAKHERHIFLFDGLMISCKTNHGQSRLPG
YSNAEYRLKEKIIMRKIQIIDKDDTSEYKHAFELVSKDENSILFAAKSAEEKSNWMAALI
SLQYRSTLDRMLDSVLLQEENEQPLRLPSPNVYRFVVEDSEDNIVFEDNLQSRNGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADRLA
IEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLETFISSVR
GKSMKKWVESIAKIIKRKKAQANGISHNITFESPPPPIEWHIWRVGHSEMLDLMTLHPIE
IARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETE
NFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAMNSVSVYRLDHTFEALQERKKRVLDE
AVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRQGKELINFSKRRK
VAEITGEIQQYQNQPYCLRIEPEIRKFFENLNPMGKIPEKEFTDYLFNKSLEIEPRNCKQ
PPRFPRKTTYPLKSPGIRPNAGRHGSTSGTLRSHPLPLEKEPSKISFSRITEAEHESAVS
APTSPNTPSTPPVSASSEFSVFLDIDLNSSYGSNSIFAPVSLPQSKTFFSSWGSFPKLSD
EPQNPPPLPPRKKMDQDVSNAKGSLKSDDDPPAIPPRQPPPPKIQPRAPAYSPFEQPLHS
PPPPPPRDPLPDTPPPVPHRPPEHFINCPLNLQPPPVGRMHRDPDWFREAGPGPSSPGTP
PSTPSPRVLRRCCVIGASHNSPGHLPAPPVPPRQNSSPQLPKLPPKTYKRELSHPPLHRL
SLLENAEAPQ
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgccgccgcagccctacgagttcttcggtgaggagaacggcccgaaatggcgg
gggctgttcgtgcccgccctgcgcaaggttcagcaacaggttcaccccaacctttcagca
aaggaagattccctctactacattgaggagttgatacttcagctgctaaacaagctatgc
atcgcccagccacgcacagtccaagacgtagaggagcgtgttcagaagacgtttcctcat
cccatagacaaatgggccattgctgatgcacagtctgccatagagaaacggaaaagaaga
aaccctctcctgctgcctgtggacaaaatacaccccttattaaaggaggtcctgggttat
aaagtagattaccatgtctctctgtatattgtggctgtcttagaatacatctcagctgat
attttaaagctggctggaaactacgttttcaatatacgacactttgagatctcccagcag
gacattaaagtatccatgtgtgctgataaggttttgatggatatgtttgatcaggatgac
attggcttggtttctctctgtgaagacgaaccttcttcttccggggaactcaattattat
gacctagtgagaaatgaaattgcagaagaaaggcaatatctccgggagctgaatctgata
ataaaagtatttcgggaagctttcctctctaacagaaagttgttcacacctaatgacatt
gatgtggtgttcagcaacatttcagatattcatgagttgacagtgaagcttttgggattg
attgaggatactgttgaaatgactgatgagagcagtcctcatcctctggctggcagctgc
tttgaggatcttgctgaggaacaagcctttgatccatatgaaaccttgtcccaggatatt
ctctctccacaatttcatgagcattttaataacttaatggcaaaacctgctgttgctctt
cacttccagtctactgctgaaggttttaaagaagctgtacgatatgtcctcccacggctc
atgcttatcccagtctatcattgtttgcactactttgagttactgcagcaactgcaggaa
tgcagtgaagatgaggaggatcgggagtgcttaaaacaagccattactgctcttctgaat
ctccagtgcagcatggagcgcatctacagcaaacactccccaagacgtcggcctggggag
ccagtttgtcgcttctataaccggcaaataagaagcaagcacttggccatcaagaaaatg
aacgaaatccagaaaaatattgatggctgggaaggcaaagatattgggcagtgctgtaat
gaattcataatggaaggcaccttgacaaaaataggagctaaacacgaacgacacatcttc
ctctttgatggcttaatgatcagctgtaaaactaaccatggccagtcacggctccccggt
tacagcaacgcggagtatagactgaaggaaaagataatcatgaggaaaatacagattatt
gataaagatgacacatctgaatataaacatgcttttgaactggtgtctaaagatgaaaac
agtatactctttgctgccaagtctgctgaagagaagagtaattggatggctgctctgatt
tccctccagtaccggagcactcttgataggatgctcgactcagtgctactgcaagaggaa
aatgaacagccactgaggttgcccagcccaaacgtgtaccgctttgtagtagaagattct
gaggataacattgtttttgaggacaacttgcaaagcaggaatgggattcccatcatcaaa
ggaggaacggttgtgaaattaattgagaggctaacgtaccatatgtatgcagatcccaat
tttgtacgtactttccttaccacgtaccgttccttttgcaagccccaggaactgctgagt
ttactgattgaaaggtttgaaatcccagagcctgagcctactgaagcagacaggctggca
atcgagaaaggggagcagcccatcagtgcagaccttaagcgatttcgcaaggaatacgtc
cagccagtgcaactcagaatattaaatgtttttcgtcactgggtggaacaccatttttat
gattttgaaagagatctggagctactagagagattggagacgtttatttcaagtgtaaga
ggaaaatccatgaagaagtgggtggaatcgattgctaaaatcatcaagagaaagaaagca
caggcaaatgggatcagtcacaatatcacctttgagagtccacctccccccatcgagtgg
cacatctggcgtgtggggcacagtgagatgctggacctcatgactctgcatcccatcgaa
atcgctcggcagctgacactgctcgagtctgacctgtacagggcagtgcagccttctgaa
ctcgtcggtagcgtttggactaaagaagataaggaaattaactccccaaatctattgaaa
atgattcgccatactacaaatctgactctgtggtttgaaaagtgcatagtggaaactgag
aactttgaagagcgagtggccgtgctgagcaggattatagaaatcctgcaagtgtttcaa
gatctgaacaatttcaatggtgttttggagatagtcagtgcaatgaactctgtgtcggtg
tacagactagatcacacatttgaggcactacaggaaaggaaaaagagagttttggatgaa
gcagtagaactaagtcaagatcacttcaaaaaatacctagctaagctcaagtcaatcaat
ccaccctgtgtgcctttctttggaatatacctaacaaatattttgaagacagaagaaggg
aatcctgacttccttaagagacaagggaaagaattaattaatttcagtaagaggagaaaa
gtggctgaaattacaggagaaattcagcagtatcaaaaccagccttactgtttgcggata
gagccagaaattcggaaattctttgaaaatctcaatcctatggggaagatacctgaaaaa
gagtttacagattatctgttcaacaagtcattagaaattgaacctcgaaactgcaagcaa
cctcctagatttcctaggaaaacaacgtacccactcaagtctcctgggataaggcccaat
gctggcaggcacggctccacctctggcaccttgagaagtcacccactgccacttgaaaag
gagccgagtaagataagtttcagtcgaatcactgaggcggagcacgaatcagcagtgtct
gcaccaacctctcccaacacaccttccactccccccgtgtctgcgtcgtcagagttcagc
gtatttttagacattgatctcaacagttcttatggtagcaacagcatcttcgctcctgtc
agtttgcctcagtcaaagactttcttcagctcatggggtagctttcctaagctaagtgat
gagcctcaaaaccctcctccgcttcctcctcgaaaaaagatggatcaggatgtttctaat
gctaagggaagtctgaaatcagatgatgatcctccagcaattccacctcggcagccgcca
cctccaaagatccagcctcgtgctcctgcttacagcccctttgagcagcctctgcacagc
cctcctcctcctccccctcgggatcctctccccgacactccacctccggtacctcaccgg
cctcccgaacactttatcaactgccctctaaacctgcagccgccgccggtgggccgcatg
cacagagatcccgactggttccgggaggctggcccaggccccagctctccaggcactcct
cccagcactccctctccacgggtgctgcgtcgctgctgcgtgatcggcgcctctcacaac
agcccgggtcacctgcctgcaccccccgtcccacccaggcagaattcaagccctcagctc
ccaaagctgccaccaaagacttacaaaagggagctctcccacccccctttgcacagactg
tctttgctagaaaatgcagaagctcctcaatga

DBGET integrated database retrieval system