KEGG   Meleagris gallopavo (turkey): 100540537Help
Entry
100540537         CDS       T01523                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00220  Arginine biosynthesis
mgp00330  Arginine and proline metabolism
mgp01100  Metabolic pathways
mgp01230  Biosynthesis of amino acids
Module
mgp_M00029  Urea cycle
mgp_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    100540537 (ARG2)
   00330 Arginine and proline metabolism
    100540537 (ARG2)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100540537 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 100540537
NCBI-ProteinID: XP_010709879
Ensembl: ENSMGAG00000011947
Position
5
AA seq 359 aa AA seqDB search
MPGTKGSLPQPARLPGSRGPHPLCARLRACAAPKSRRSVRDHIFNLCFPLDPCLITPLSL
FVVVFPGCQLFDFGDLNFTQVPNDELYNNLIYYPRSVGLASQVLADAVSRAVAAGHSCVT
IGGDHSLALGSISGHARQCPHLGVIWVDAHADINTPLTTPSGNLHGQPLSFLLRELQDKV
PQLPGFSWLKPCLSASDIVYVGLRDVDPAEYYILKNYDIQYFSMRDVDRLGIQKVMERTF
EQLMGRRQRPIHLSFDIDAFDPSLAPATGTPVLGGLTYREGMYIAEEIHNTGMLSAVDMV
EVNPLLGASQEEVNATANLAVDVIATCFGQTREGAHTAFDELPTPSSPDESDSEEQVRI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaacaaagggctcgctgccgcagcccgcccgccttcccggctcccggggaccg
catccgctctgcgctcggctgcgagcgtgcgctgctcccaaaagccggagaagcgtcaga
gaccatattttcaatttgtgttttcctttggatccttgtttaataactcccctttctctt
tttgttgttgtgtttccaggatgccaactgtttgactttggagatttgaatttcactcaa
gttcccaatgatgaactgtacaacaacctgatttattacccacggtcagtggggttagcc
agccaggtactggccgatgctgtaagcagagcggtagctgctggacacagctgtgtcact
ataggaggtgatcacagcttggcacttggttccatcagtggccacgcacgacagtgccca
catctcggtgtgatctgggtggatgcacatgctgatattaacactcctcttacaactccg
tctggaaacctccatggacagcctctctcatttctcttgagagaacttcaagataaagtc
ccacaacttcctggcttttcctggctaaagccctgtctttcagcatctgatattgtgtat
gttgggttgagggatgtggatcctgctgaatactatattttgaaaaactatgacatccag
tatttttccatgagggatgttgatcgccttggaatccagaaagttatggaaaggacattt
gaacagctgatgggcaggagacagagaccaattcacctgagttttgacatcgatgctttt
gatccctcactggctccagcaactgggactcccgttctgggtggattaacttacagagaa
ggcatgtacattgcagaggaaatacacaacacaggaatgctttcagctgtagacatggtt
gaagtcaatccgctgcttggagcttctcaagaggaagtgaatgcaactgctaatcttgca
gttgatgtgatagcaacatgctttggacagacaagagaaggggcgcacaccgcttttgat
gaactcccaacacccagttctccagatgaatctgacagtgaagagcaagtgaggatttaa

DBGET integrated database retrieval system