KEGG   Meleagris gallopavo (turkey): 100540797Help
Entry
100540797         CDS       T01523                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00010  Glycolysis / Gluconeogenesis
mgp00562  Inositol phosphate metabolism
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100540797 (MINPP1)
   00562 Inositol phosphate metabolism
    100540797 (MINPP1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100540797 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100540797 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 100540797
NCBI-ProteinID: XP_003207851
Ensembl: ENSMGAG00000001553
Position
8
AA seq 335 aa AA seqDB search
MKSSLSTNSTTYPEGFHYAWRGLTFHTKEAQAKASINKTIDFAVLPVSFPRATEKHALLS
LSETEIEVNDALMRFFDRCDKFVALVEDNDTAMYQVNAFKEGPEMRKVLEKVASALCLPA
GELNADLVQVAFLTCSYELAIKNVTSPWCSLFSEEDAKVLEYLNDLKQYWKRGYGYDINS
RSSCILFQDIFQHLDKAVDESRSSKPISSPLIVQVGHAETLQPLLALMGFFKDAEPLRAN
NYVRQAHRKFRSGRIVPYAANLVFVLYHCDQAKTSKEEYQVQMLLNEKLLLFHHSNETIS
TYADLKSYYKDILQNCHFEEECELPKFNGTVTDEL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctcactgtcaacaaattctacaacataccctgaaggtttccattacgcttgg
cgaggactaacctttcacaccaaagaggctcaagccaaagcctccatcaacaagacgatt
gactttgcagtactacctgtttcctttcccagggccactgagaaacacgcgctgctttca
ctttcagagacggagatcgaagtaaacgacgccctgatgaggttttttgatcgctgcgac
aagttcgtggccttggtggaggacaacgacacggccatgtaccaagtgaacgctttcaag
gagggcccagagatgaggaaggtgttggagaaggtggcgagtgccctgtgtctgccggcc
ggggagctgaacgcagatcttgttcaagtagctttcctcacttgctcgtatgagttggct
ataaaaaatgtgacctccccgtggtgttcgctcttcagtgaagaggatgctaaggtattg
gagtacctgaatgacctgaagcaatattggaagagaggatatggctatgacatcaatagt
cgctccagctgcattttattccaggatatcttccaacacttggacaaagcagtggatgag
agcagaagttcaaaacccatttcttcacctttgattgtacaagttggacatgcagaaaca
cttcagccacttcttgctcttatgggcttcttcaaagatgctgagcctctccgggcaaac
aattacgtgcgccaggcgcatcggaagttccgcagtggccggatagtgccttatgcagcc
aacctggtgtttgtgctctaccactgtgaccaggcgaagacctcgaaggaggagtaccaa
gtgcagatgttgctgaatgaaaagctactgctcttccatcactcgaacgaaaccatctct
acatacgcagacctcaagagctattacaaggacatccttcaaaactgtcactttgaagaa
gagtgtgaattgcccaaattcaacggtactgttactgacgaactttga

DBGET integrated database retrieval system