KEGG   Meleagris gallopavo (turkey): 100540877
Entry
100540877         CDS       T01523                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mgp04040]
    100540877 (ASIC1)
Ion channels [BR:mgp04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   100540877 (ASIC1)
SSDB
Motif
Pfam: ASC DUF4074
Other DBs
NCBI-GeneID: 100540877
NCBI-ProteinID: XP_010718839
Ensembl: ENSMGAG00000010535
UniProt: H9H1S1
Position
17
AA seq 527 aa
MMDLKVDEEEVDSGQPVSIQAFASSSTLHGISHIFSYERLSLKRVVWALCFMGSLALLAL
VCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLN
NRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQC
SPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDET
SFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEF
YDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYC
VCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIE
QKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCRKNHKRNNTD
KGVALSMDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgatggacctgaaggtggacgaggaggaggtggacagcgggcagccggtgagcatccag
gccttcgccagcagctccaccctgcacgggatctcacacatcttttcctacgagcggctg
tcgctgaagcgcgtggtctgggcgctctgcttcatgggttcactggcactgctcgccctc
gtctgcaccaaccgcatccagtactacttcctctacccgcatgtcaccaagctggacgag
gtggctgccaccaggctcaccttccctgctgtcaccttctgcaacctcaacgaattccgc
ttcagccgggtgaccaagaacgacctgtaccacgccggtgagctcctcgccctgctcaat
aacagatacgagatcccggacacacagacagctgatgagaagcaactggaaatcctgcag
gataaggcgaacttccgaaacttcaagcccaaacctttcaatatgttggagttttatgac
cgtgccggccacgacatccgggagatgctgctctcctgcttcttccgtggggagcagtgc
agccccgaagacttcaaagtggtgttcacacgctatgggaagtgctacaccttcaatgca
gggcaggacggcaaaccccggctcatcaccatgaaagggggcactggcaacggcctggag
atcatgctggacatccagcaggacgagtatctcccagtgtggggggaaacagatgagacc
tcatttgaagctgggatcaaggtgcagatccacagccaggatgagcctccactcatcgac
cagctgggcttcggtgtggcacctggcttccagacctttgtgtcctgccaggaacagcgg
ctcatctacctgccacctccctggggcgactgtaaggccacaacgggtgactcggagttc
tacgacacttacagcatcaccgcctgccgcatcgactgcgagacccgctacctggtggag
aactgcaactgccgcatggtgcacatgccaggcgatgccccttattgcaccccagagcag
tacaaggagtgcgcagatccggccttagatttcctggtggagaaggacaatgagtactgt
gtctgtgagatgccctgcaacgtcacccgctatggcaaagagctctccatggtgaagatc
cccagcaaagcatccgccaagtacctggccaagaagtacaacaagtcggagcagtacatc
ggggagaacatcctggtgctggacatcttctttgaagcactaaactatgagacgatcgag
cagaagaaggcgtatgaggtggctggattgctgggtgacatcggaggacagatggggctg
tttatcggggccagcatcctcactgtgctggagctgtttgactacgcctatgaggtgatc
aagcaccggctgtgccggcggggcaagtgccgcaagaaccacaagaggaacaacacggac
aagggcgttgcgctgagcatggatgacgtgaaacgccacaatccctgtgagagcctacgg
ggtcacccggccggcatgacgtacgcagcgaacatcctacctcaccacccggcccggggc
acctttgaggacttcacctgctaa

DBGET integrated database retrieval system