KEGG   Meleagris gallopavo (turkey): 100541011Help
Entry
100541011         CDS       T01523                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04012  ErbB signaling pathway
mgp04068  FoxO signaling pathway
mgp04137  Mitophagy - animal
mgp04140  Autophagy - animal
mgp04141  Protein processing in endoplasmic reticulum
mgp04210  Apoptosis
mgp04217  Necroptosis
mgp04310  Wnt signaling pathway
mgp04510  Focal adhesion
mgp04530  Tight junction
mgp04620  Toll-like receptor signaling pathway
mgp04621  NOD-like receptor signaling pathway
mgp04622  RIG-I-like receptor signaling pathway
mgp04625  C-type lectin receptor signaling pathway
mgp04910  Insulin signaling pathway
mgp04912  GnRH signaling pathway
mgp04914  Progesterone-mediated oocyte maturation
mgp04920  Adipocytokine signaling pathway
mgp04933  AGE-RAGE signaling pathway in diabetic complications
mgp05132  Salmonella infection
mgp05164  Influenza A
mgp05168  Herpes simplex infection
Module
mgp_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100541011 (MAPK9)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100541011 (MAPK9)
   04012 ErbB signaling pathway
    100541011 (MAPK9)
   04310 Wnt signaling pathway
    100541011 (MAPK9)
   04068 FoxO signaling pathway
    100541011 (MAPK9)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100541011 (MAPK9)
   04137 Mitophagy - animal
    100541011 (MAPK9)
  Cell growth and death
   04210 Apoptosis
    100541011 (MAPK9)
   04217 Necroptosis
    100541011 (MAPK9)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100541011 (MAPK9)
   04530 Tight junction
    100541011 (MAPK9)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100541011 (MAPK9)
   04621 NOD-like receptor signaling pathway
    100541011 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    100541011 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    100541011 (MAPK9)
  Endocrine system
   04910 Insulin signaling pathway
    100541011 (MAPK9)
   04920 Adipocytokine signaling pathway
    100541011 (MAPK9)
   04912 GnRH signaling pathway
    100541011 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    100541011 (MAPK9)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100541011 (MAPK9)
  Infectious diseases
   05132 Salmonella infection
    100541011 (MAPK9)
   05164 Influenza A
    100541011 (MAPK9)
   05168 Herpes simplex infection
    100541011 (MAPK9)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100541011 (MAPK9)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100541011 (MAPK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 100541011
NCBI-ProteinID: XP_010717408
Ensembl: ENSMGAG00000007540
Position
15
AA seq 424 aa AA seqDB search
MSESKSDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESDRDKLKTSQARDLLSK
MLVVDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVNSNTSPSQSSSINDISSMSTEQTLASDTDSSLDALTGPL
EGCR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagtaaatctgatagtcagttttacagtgttcaagttgcagattcaacattc
actgtactaaaacgttaccagcaattgaagcctataggatcaggggcacagggcattgtt
tgtgctgcgttcgatacggtccttggaataaacgttgctgtaaagaagttgagccgtcct
tttcagaatcaaacccacgcgaaaagagcttacagagagcttgttcttttaaaatgtgtc
aatcacaaaaatataattagcttattaaatgtatttacaccgcagaagtcactagaggaa
tttcaggatgtatatttggttatggagctgatggatgccaacttgtgccaagttattcat
atggaattggatcatgaaagaatgtcttatctcctttaccagatgctatgtggtatcaaa
catctccactcagctggtatcatccacagagatttgaaacccagcaacatagtagtaaaa
tcagattgtacactcaaaatccttgattttggactggcaagaacagcgtgtactaatttt
atgatgactccatatgtagtaacacgatattacagagcgccagaggttatccttggaatg
ggatataaagagaatgttgatatctggtcagttggttgcatcatgggagaattggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcaatggaataaagtaattgaacaa
ctaggaacgccctcagcagaattcatgaagaaactacagcctacagtgaggaattatgta
gaaaacaggccaaaatatccaggtattaaatttgaagagctctttccagactggatattt
ccatcagaatcagaccgtgacaagttaaaaaccagtcaagctagagatttattatcaaaa
atgcttgtagtagatccagacaagagaatttccgtagatgaggccttacgtcatccctat
attactgtctggtatgatccagctgaagcagaagctcctccacctcaaatttacgatgca
caactggaggagagagaacacgcaattgaagaatggaaagaattaatatacaaagaggta
atggattgggaagaaagaagcaagaatggtgtggtaaaagaccagccctcagatgcagca
gtgaatagcaacaccagtccttcccagtcatcatctatcaatgacatttcatccatgtca
acagagcaaacattggcttcagatacagacagcagcctcgatgccttgacaggacccctc
gaaggatgccgatga

DBGET integrated database retrieval system