KEGG   Meleagris gallopavo (turkey): 100541414
Entry
100541414         CDS       T01523                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100541414 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mgp03000]
    100541414 (MECOM)
Transcription factors [BR:mgp03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    100541414 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 zinc_ribbon_15 PyrI_C
Other DBs
NCBI-GeneID: 100541414
NCBI-ProteinID: XP_010715248
Ensembl: ENSMGAG00000010302
Position
11
AA seq 1052 aa
MKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPHSAFSMVEEDFQK
KLENENDLRDVHEIQECKECDQVFPDLQSLEKHMLSHSEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHK
HIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMNHANPGLADYFGANRHPAGLTFPTAPGF
SFSFPGLFPSGLYHRPPLLPTSSPVKGLPSADQTNKSQSPLMTNPQILPATQDILKALNK
QPSVGENKPVELQPERSSEERPHEKLSDQSESSDLDDVSTPSGSDLETTSGSDLESDIES
EKEKFKENGKMFKDKVSSLQSLASINNKKEHSNHSIFSPSLEEQTAVSGAVNDSIKAIAS
IAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKVEPQSP
SELKKIPKGSSESPFDLTTKRKEEKPVTPIPSKPAAPPAASQDQPLDLSMGSRSRASGTK
QAEPRKNHVFGEKKGGDLEQRKTSEASLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKY
LRPSPGFLFHPQFQLPDQRIWMSAIENMAEKLESFSALKPEANEMIQSMPSMFNFRAPPS
ALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRH
VRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDK
EDSYFTEIRNFIGNSNHNNQSPRNSEERMNGSHFKDEKAMVNSQNSDLLDDEEAEDEVMM
DEEDEESEIAGKTVKEPVTSDIHEGTPEEDYEETSTLDMNCKASPGRYKEEEYNKTGLSA
LDHIRHFTDSLKMRKMEENQYSEAELAAFNTSQLPEDLKQPLYRKSKSQAYAMMLSLSDK
DSLHSTSHNSPNMWHSMARAAESSAIQSISHV
NT seq 3159 nt   +upstreamnt  +downstreamnt
atgaagagtgaagattattcacatgaaacaatggctccggacattcatgaggagcgccag
tatcgctgcgaggactgcgaccagctctttgagtccaaggctgagctggtggaccaccag
aagttcccctgcagcacaccacactccgccttctccatggtggaggaggacttccagaaa
aagcttgagaatgagaacgaccttcgggatgtgcacgaaatccaggagtgtaaagagtgt
gatcaagtcttcccagacttacaaagcctggagaagcacatgctgtcccacagcgaggag
cgggagtacaagtgtgaccagtgccccaaagctttcaactggaagtccaacttgatacgt
caccaaatgtcgcatgacagcggcaagcactacgagtgtgagaactgtgccaagcaggtt
ttcacggaccccagcaacctccagaggcacattcgttcccagcatgttggggctcgtgct
cacgcttgtccagagtgtggcaaaacctttgccacatcttcaggcctcaaacagcataaa
cacatccacagcagtgtcaaaccctttatatgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagattttgt
gagggcaagaaccattttgcagcaggaggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgaatcatgcaaatccgggccttgct
gactattttggagccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccccggtctgtttccttcaggcttgtaccacaggccacctttgctacct
actagctctcctgttaaaggactaccaagcgcagatcagacaaacaaaagtcaaagtccc
ctcatgaccaaccctcagatactgccagccacccaggatattttgaaggcactaaataag
caaccatctgtaggggaaaataagccagtggagcttcaaccagagaggtcctctgaagag
aggccgcatgaaaaactcagtgaccagtcagagagtagtgaccttgacgatgtcagtacc
cccagtggcagtgacctggaaaccacctctggctctgatctggaaagtgacattgaaagt
gagaaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagctctctgcag
agtttggcttcaataaataataagaaagaacacagcaatcattccattttctcaccatct
ttagaggagcagactgcggtgtcaggagcggtgaatgattctataaaggctattgcttct
attgctgaaaaatactttggttcaacaggacttgtggggctgcaagacaaaaaagttgga
gccttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatg
tatccatttcctgatagagacttgagaccgttacccttgaaagtggagccccaatcaccc
agtgaactcaagaagatcccaaagggaagctctgagtctccctttgacctcaccactaag
cgtaaggaggagaagcccgttactcccataccctcaaagccagcagctccgcctgcggca
agccaggaccagcctctagatctgagcatgggcagtagaagtcgagccagcggcacaaaa
caggccgagcccaggaaaaaccacgtctttggtgagaagaaaggaggtgacctcgagcag
aggaaaacgtcggaggcctctttgcagcacgcccgaccgactcccttctttatggatccc
atttacagagtagagaaaagaaagttaactgacccactcgaagctttaaaagagaaatac
ttgagaccttccccgggattcttgtttcatccacaattccaattgcctgatcaaagaatt
tggatgtcagctatagaaaacatggccgaaaagctggagagtttcagtgccttgaagcca
gaggccaatgagatgatccagtcaatgccatccatgttcaacttccgagcccctccaagt
gctctgcctgagaccctcctgcgcaagggcaaggagcgctacacctgcagatactgtggc
aagattttccccagatctgcaaacctaacccgtcacctgagaacgcacactggagagcag
ccctacagatgcaaatactgtgacaggtcctttagcatatcttccaacctgcagagacac
gtccgtaatatccacaataaagagaagccattcaagtgtcacttgtgtgacaggtgtttt
ggtcaacaaaccaatcttgacagacatctaaaaaagcatgagaatggcaacatgtctggt
actgcaacatcttcacctcactcagaactggaaagcacaggggccatcctagatgacaag
gaagattcttacttcacagaaattaggaattttattggaaacagcaaccacaacaatcaa
tccccccgaaactcagaggagagaatgaatggcagccactttaaggatgaaaaagccatg
gtaaacagccagaactcagatttgttggatgacgaagaggcagaagatgaagtaatgatg
gacgaagaagatgaagaaagtgaaattgcagggaaaacagtcaaagagcctgttacaagt
gacatacacgaggggactcctgaggaggattacgaggaaacgagtactttggacatgaac
tgcaaagcttcccctggcaggtataaagaggaggaatataataagactggactttcagct
ttggaccacataaggcacttcacagatagcctcaaaatgaggaaaatggaagaaaatcaa
tatagtgaagctgaattggcagctttcaatacttcccagctgccagaggacctaaaacaa
ccattgtacaggaaatccaaatcccaggcgtacgccatgatgctgtctctctctgacaag
gactcccttcattctacatcccacaattctcccaatatgtggcacagcatggcgagagct
gcagaatccagtgccatccaatccatcagtcacgtatga

DBGET integrated database retrieval system