KEGG   Meleagris gallopavo (turkey): 100541563Help
Entry
100541563         CDS       T01523                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma 1
  KO
K05635  laminin, gamma 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04510  Focal adhesion
mgp04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100541563 (LAMC1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100541563 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 100541563
NCBI-ProteinID: XP_019473935
Ensembl: ENSMGAG00000001723
Position
10
AA seq 1488 aa AA seqDB search
IFVVSCFSLSHSFVPSPAGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWVPYQYYSGS
CESTYNKVNRGFIRTGEDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVSLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECIRNELG
KLVCNCKHNTFGDDCEKCLPFFNDRPWRRATAESANECLPCDCNGRSQECYFDPELYRST
GHGGHCSGCRDNTDGAHCERCRDSFYRLGSEEGCLPCSCNPVGSLSTQCDSYGQCSCKPG
VMGEKCDRCQPGFHSLSEAGCRPCSCNPAGSTGECNMETGRCTCKDNVEGFHCERCKPGF
FHLDPSNPRGCTPCFCFGHSSVCANAVGYSVYSITSSFQFGEDEWHAEQRDGSQVPVQWS
PETQDISVISDSYFPIYFVAPRKFLGNQVLSYGQNLTFSFRVDRRDTRLSAEDLVLEGAG
LRVSVPLIAQGNSYPSESPLTYTFRLHEAADYPWRPALSAFDFQKLLHNLTAIKIRGTYS
ERSAGHLDDVTITSAVPGAGVPAAWVESCSCPAGYEGQFCERCSPGYRRETPGLGPYSPC
VPCSCNGHSETCDPETGVCDCRDNTAGSQCEKCSDGYYGDATAGTALDCQPCPCPGGSSC
AVVPRTREVVCTSCQTGTTGKRCELCDDAYFGDPLGENGAVRPCRLCQCNDNIDPNAVGN
CNRQTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCRACHCNPYGTVNQQTSCNQV
TGQCECLSHVTERDCSACEPGFFNLQSGRGCERCDCHALGSTNGQCDIWTGQCECQPGVT
GQRCDRCEANHFGFGPEGCKPCDCDPEGSRALQCREDGRCECKEGFVGNRCDQCEENYFY
NRSWPGCQECPACYRLVKDKVAEQRERLRELENLIANLGTGEETVTDQAFEERLKQAERD
VMELLREAQNSKDVDQGLMDRLRDINSTLTSQLSRLRNIQNTVQETENLAEQARGRVEDT
EDLIAMASDMLEKAKMAAGNVSITPPESSGDPNNMTLLAEEARRLAERHKQEADEIVRIA
KAANDTSTEAYQLLLKTLAGENQTARDIDELNQKYNQARNISRDLERQANSVLEEAEEAG
NKALQIYANLTNLPTVDTTGLESEANKIKKEAEELDQLIARKLKDYEDLREDMKGKELEV
KNLLEKGKTEQQTADQLLARADAAKALAEEAARKGNGTLQEANTILSNLKDFDKRVNDNK
TAAEEALKKIPAITQTIAEANNKTHQAELALGNAAADAREAKTRADDAEKIASAVQKSAA
ATRAEADKTFSDVTGLAREVDDMMKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAED
NARKAKNSVNSLLAVINDLLDQLGQLETVDLNKLNEIEGTLNSAKDQMKDSDLDQKVAFL
EREARKQDDAIQSYNRDIEEILKDISNLEDIRKTLPSGCFNTPSIEKP
NT seq 4467 nt NT seq  +upstreamnt  +downstreamnt
atctttgttgtaagttgtttcagcctttctcactcctttgttccatctcctgcaggaaag
gcctttgacatcacatacgtgagactgaagttccacaccagcaggccagaaagcttcgcc
atctacaaacgcacacgggaggatggcccgtgggtgccctaccagtattacagtgggtct
tgtgagagcacctataacaaagtcaaccggggctttattcggactggggaggacgagcag
caggctctctgcacggatgagttcagtgacatctcccccctcactgggggcaacgtggct
ttctcaacgttggagggacgtcccagcgcctacaactttgacaacagccctgtgctgcag
gaatgggtgacggccaccgatattcgggtgagcctcaaccgcctcaacaccttcggagat
gaagttttcaatgatcccaaagtcctcaagtcgtattactacgcgatttctgattttgcc
gtgggtggtagatgcaaatgcaatggccacgcgagcgagtgcataaggaacgagcttggg
aagctggtctgcaactgcaagcacaacacctttggggacgactgtgagaagtgccttccc
ttcttcaatgaccggccgtggaggagagcaacagcagaaagtgccaacgagtgcttgcct
tgtgactgcaatgggagatcacaggagtgctatttcgaccctgagctgtaccgctccacc
ggccacggcgggcactgctcgggctgccgggacaacaccgacggcgcccactgcgagagg
tgcagggacagcttctaccgcctcgggagcgaggagggctgcctgccctgcagctgcaac
cccgtgggctccctcagcacgcagtgtgatagctatggccagtgcagctgcaaacctgga
gtcatgggagagaaatgtgaccgctgccagccgggcttccactccctctctgaggctggg
tgcaggccctgttcttgcaatcctgctggcagcacaggtgaatgcaacatggaaacagga
cggtgtacttgcaaggacaatgttgagggcttccactgtgagagatgcaaacctgggttt
ttccatctggatccctcaaatccaagaggctgtaccccctgcttctgttttggacactct
tcggtttgcgccaatgccgttggctacagcgtgtacagcatcacctccagctttcagttt
ggagaggacgagtggcatgctgagcaacgtgatggctcccaagtcccagtgcagtggagt
ccagagacccaggacatctctgtcatctcagacagttacttccccatctactttgttgca
ccacgcaagttcttgggcaaccaagttttgagctacggtcagaatctgaccttctccttc
cgcgtggacagacgggacacacgtctctctgcagaggacctagtgctggaaggggccggg
ctgcgtgtgtcggtgcctctcattgcccagggcaactcgtaccccagtgagagcccactg
acctacaccttcaggctccatgaggctgccgattacccgtggaggcctgctctctctgca
ttcgacttccagaagcttcttcacaatttgactgccatcaagatccgtggaacgtacagt
gagagaagtgccggccacctggatgacgttaccatcaccagcgctgtcccaggggccggc
gtgcctgcggcgtgggtggagagctgctcctgccctgcaggctatgaggggcagttctgt
gagcgctgctcccccgggtaccgccgagagacccctggcctgggaccctacagcccctgc
gtgccttgcagctgcaatgggcacagcgagacctgtgatcctgagacgggcgtatgtgac
tgcagggataacactgcgggctctcagtgtgagaagtgcagcgatgggtactacggagat
gcgacagcgggcacagccttggactgccagccctgtccatgccctggtggctccagctgc
gctgtcgtgccccgcacaagggaggttgtgtgcaccagctgccagacgggcaccacaggc
aagaggtgtgagctgtgtgacgatgcctactttggagacccgctgggtgaaaatggggct
gtgaggccatgtcgcctgtgccagtgcaatgacaacatcgatcccaacgctgtgggcaac
tgcaaccggcagacaggagagtgcctcaagtgcatctacaacacggccggcttctattgc
gaccgctgcaaggatggcttctttgggaaccccttggcccccaaccctgctgacaaatgc
cgggcttgtcactgtaatccctacggcaccgtgaatcagcagacgagctgcaaccaagtg
acagggcaatgtgagtgcctttcccatgtcaccgagagggactgcagtgcctgcgagccc
ggcttcttcaacctgcagagcggccgaggctgtgagaggtgtgactgccacgctctgggc
tccaccaacggccagtgtgacatatggacggggcagtgtgagtgccagcccggcgtcacc
ggccagcgctgcgaccgctgcgaggccaaccactttgggttcggccccgagggctgcaaa
ccatgtgactgtgacccggagggctcacgcgccctgcagtgccgtgaggatggtcgctgt
gagtgcaaggagggctttgtggggaaccgctgcgaccagtgcgaggagaactacttctac
aacaggtcatggccaggctgccaggagtgccctgcatgttacagattagtgaaagataag
gtggcagagcaacgagaaaggctacgggagctggaaaaccttatagcaaacctgggcacg
ggagaagaaactgtcactgatcaagccttcgaggagaggttgaagcaggcagaaagagat
gtcatggagctgctccgagaagcacagaacagcaaagacgtagatcagggtctcatggat
cgtctcagagacatcaacagcacgctgacaagtcagctcagcaggctgaggaacatccag
aacacagtgcaggagacagagaacctggcagagcaagcccggggccgggtggaggacaca
gaggacctgattgcaatggcttctgatatgttggagaaggcaaagatggcagctggcaac
gtgtccattacacccccggagtcgagtggtgaccccaacaacatgactctattggcagaa
gaggctcgccggctggctgagaggcacaaacaagaagctgatgagattgttcgcattgcc
aaggcagccaacgatacttccacagaagcgtatcagctgctgctgaagaccctggctggg
gaaaaccaaacggcacgtgatattgatgagctcaaccagaaatataaccaagcaagaaac
atttctcgagatctggagagacaggccaacagtgtgcttgaggaggcagaggaagctgga
aataaggccctccagatctatgctaatctcaccaatctgcccactgtggacaccacgggg
ctggagagtgaagcaaataagatcaagaaggaagcggaggagttagatcagttaatagca
aggaagttgaaggactatgaagacctgagggaagacatgaaaggaaaggagctggaagtc
aagaacctcttggagaaagggaagacggagcagcagactgcagaccagctcctggctcga
gcagatgcagcaaaagccctggctgaggaagctgctcggaagggcaatggcacactgcag
gaggccaacaccattctcagcaacctgaaagatttcgataagcgggtgaacgacaacaag
acagcagctgaggaggctctgaagaagattcctgccattacccagaccattgctgaagcc
aacaacaagacccaccaggcagagctggctcttggcaatgctgctgctgatgcccgtgaa
gccaaaactagagcagatgatgctgagaaaattgccagcgctgttcagaagagtgctgct
gctaccagagcagaagcggacaagaccttctctgacgtgacggggctggccagagaggtg
gatgacatgatgaagcaactccaggaggcagaaaaagagctgaagcgtaaacaagatgat
gctgaccaggatatgatgatggcaggcatggcctcacaggcagcccaggaggcagaagac
aatgcaagaaaagcaaaaaactctgtgaacagcttgcttgctgtcattaatgacctttta
gaccaactagggcaactggagacggtggacttgaacaaactgaatgagattgagggtacc
ctgaacagtgccaaagaccagatgaaagatagcgacctggaccagaaggtggctttcctt
gagagagaagccaggaagcaagatgatgcgatacagtcctacaacagggacattgaggaa
atcctgaaagacattagcaacctggaggacatcaggaagaccttgccatctggctgtttt
aacaccccgtccattgagaaaccctaa

DBGET integrated database retrieval system