KEGG   Meleagris gallopavo (turkey): 100541896Help
Entry
100541896         CDS       T01523                                 

Definition
(RefSeq) histone H2B 8-like
  KO
K11252  histone H2B
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100541896
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100541896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100541896
NCBI-ProteinID: XP_003202247
Ensembl: ENSMGAG00000015706
Position
1
AA seq 164 aa AA seqDB search
MERDNFESLNLHTASISTGDGAIVPASIQRYRQRRACAMPEPAKSAPAPKKGSKKAVTKT
QKKGDKKRRKTRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggacaacttcgagtcccttaatttgcataccgcctctataagtacgggcgac
ggcgccattgtacctgcgtcgatccagcggtataggcagcggcgggcgtgcgcgatgccg
gaaccagcgaagtcggctcctgcccccaagaagggctccaaaaaggcggtcaccaagacc
cagaagaagggtgacaagaaacgtagaaagacaaggaaagagagctactcgatctacgtg
tacaaggtgctgaagcaggtgcaccccgacacgggtatctcgtccaaggccatgggtatc
atgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtcgcgcctggcg
cactacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcggctgctg
ctgcccggcgagctggccaagcacgcggtctcggagggcaccaaggcggttaccaagtac
accagctccaagtag

DBGET integrated database retrieval system