KEGG   Meleagris gallopavo (turkey): 100542127
Entry
100542127         CDS       T01523                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100542127 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100542127 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mgp03000]
    100542127 (CREB1)
   03029 Mitochondrial biogenesis [BR:mgp03029]
    100542127 (CREB1)
Transcription factors [BR:mgp03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100542127 (CREB1)
Mitochondrial biogenesis [BR:mgp03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100542127 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 100542127
NCBI-ProteinID: XP_003207546
Ensembl: ENSMGAG00000008360
UniProt: G1N8F7
Position
7
AA seq 327 aa
MTMESGAENQQSGDAAVTEAETQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETAAPAIATVTVPTPIYQTSSGQYIAITQGGAIQLS
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagccgttacagaggca
gaaacccaacagatgacagtacaggcacaaccacagattgcaacgttagcccaggtatct
atgccagcagctcacgcaacatcttctgcacccacggtgaccttagttcagctgcccaat
gggcagacagttcaagtgcacggcgtaattcaggctgcccagccatcagttattcagtct
ccacaggtccagacagttcagatctcaactatagcagaaagtgaagactcacaggaatca
gtggacagtgtcacagactcacagaaacggagagaaattctttccagacgaccctcctac
agaaaaattttgaatgacttgtcctcagacgccccaggagtgccaaggatcgaagaggaa
aagtctgaagaggaaacagcagcacctgccatcgccactgttacggtgccaactcccatt
taccaaaccagcagtgggcagtacattgctattacgcaaggaggagcaattcagttgtct
aacaatggcacagatggagtacaaggtctccagacattgacaatgaccaatgcagctgca
acacaacctggcactaccattttgcaatatgcacagaccacagatggacaacagatactt
gtacccagcaaccaagttgttgtacaagctgcctcgggagatgtgcagacctaccagatt
cgcaccgccccaaccagcaccattgcaccgggagtagtcatggcatcatctccagcactt
ccaacccagccagcagaagaggccgcacggaagagagaagtgcgtctaatgaagaacaga
gaggcagcacgtgaatgtcgcaggaagaaaaaggagtatgtgaaatgtctagaaaatcgt
gtggctgtgcttgaaaaccaaaacaagacactgattgaggagttgaaagcacttaaagac
ctttactgccacaaatcagattaa

DBGET integrated database retrieval system