KEGG   Meleagris gallopavo (turkey): 100542432Help
Entry
100542432         CDS       T01523                                 

Definition
(RefSeq) histamine N-methyltransferase-like
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00340  Histidine metabolism
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    100542432
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100542432
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     100542432
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100542432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_16 DsrC
Motif
Other DBs
NCBI-GeneID: 100542432
NCBI-ProteinID: XP_003207782
Ensembl: ENSMGAG00000012535
UniProt: G1NIU0
Position
7
AA seq 292 aa AA seqDB search
MASPMKNLLTDLSRYVRCFRVFLAKSTEHQTMKQFVEQQLPGLLASIGSGKSAINILSVG
GGAGEIDLQIISAVQASYPGVAINNEVIEPSADQILKYKERVAATSNLDNVKFTWHEETA
NEYERRMKAEKKSQKWDFIHMIQMLYYVKDIPAIIRYFHSLLDAQAKLLIILVSGTSGWE
TLWTKYGSSFPTDDLCTFISSANIKGILDSIGLKYKIYELPSHMDITCCFTEGDNDGELL
LDFLTETCEFSKNAPPELRQQILEELRKPGCSENRNGKVFFNNNMSVIMVEP
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcccatgaagaacttgctgacagacctcagccgctacgtccgctgcttccgc
gtcttcctggccaagtctacagagcaccagaccatgaagcagtttgtggagcagcagctg
ccaggcctgctggcaagtattggaagcgggaagtctgcaatcaatattctaagtgtcggt
ggtggagcaggtgagattgacctgcagatcatttcagctgtgcaagccagttatccaggt
gtcgccatcaacaacgaggtgatagagccgagtgctgatcaaatcctcaagtacaaagaa
cgtgtggctgcaacctcaaacctcgacaatgtaaagtttacctggcatgaggagacagct
aatgaatatgaaaggagaatgaaggcagaaaagaagtctcaaaaatgggacttcattcac
atgattcagatgctgtactatgtgaaagacatccctgcaattatccggtacttccacagc
ctcctggatgcacaggcaaagctcctcatcattctggtgtcaggaaccagtggctgggaa
acactctggacgaagtatgggtcttcctttcctacagatgacctctgcactttcatatcc
tctgctaacatcaaagggattctagattcaattgggctgaagtacaagatctatgagctc
ccatcccacatggacataacttgttgctttactgaaggggacaatgatggggagctgttg
ctggatttcttgacagaaacctgtgagttttcaaaaaatgctcctcctgaactaaggcaa
cagatactggaagaattaagaaagccgggatgcagtgaaaacagaaatgggaaggtgttt
tttaataacaacatgagtgtaataatggttgagccctga

DBGET integrated database retrieval system