KEGG   Meleagris gallopavo (turkey): 100542961Help
Entry
100542961         CDS       T01523                                 

Gene name
DCXR
Definition
(RefSeq) dicarbonyl and L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00040  Pentose and glucuronate interconversions
mgp01100  Metabolic pathways
Module
mgp_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100542961 (DCXR)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     100542961 (DCXR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short DUF1776
Motif
Other DBs
NCBI-GeneID: 100542961
NCBI-ProteinID: XP_010719743
Ensembl: ENSMGAG00000005237
Position
20
AA seq 181 aa AA seqDB search
WAAAEAAVSAAGPFELLVNNAAVAMLQPFLQVTREAVERSFDVNFHAVLHVSQIVARQMI
AQGLPGAIVNVSSQASQRALRDHAVYCSTKSALDMLSKVMAMELGPHKIRVNTVNPTVVM
TDMGRINWSDPQKSAAMINRIPLGKFAEVDDVVNSILFLLSDKSAMTTGSSLMVDGGFLV
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
tgggccgccgcggaggcggcggtgagcgcggcggggcccttcgagctgctggtaaacaac
gcggccgtggcgatgctgcagcccttcctgcaggtgacccgggaggccgtggagcggtct
tttgatgtcaatttccatgccgtgcttcacgtttctcagatcgttgctcggcagatgatt
gcacagggactgccaggtgcaattgtgaatgtctccagccaggcatctcagcgtgccctg
agggatcatgctgtttactgttctaccaaaagtgctttggatatgctgagtaaggtaatg
gcaatggaactgggaccccacaagataagggtgaacactgtgaatcccacagtagttatg
accgacatggggagaattaactggagtgatcctcagaaatctgctgccatgattaaccgg
attccactaggaaagtttgcagaggtggatgatgtggtgaacagcattcttttcctgctc
agtgacaagagtgctatgacaactggcagctcactgatggttgatgggggatttctcgtc
tcctaa

DBGET integrated database retrieval system