KEGG   Meleagris gallopavo (turkey): 100543016Help
Entry
100543016         CDS       T01523                                 

Gene name
MRPL22
Definition
(RefSeq) mitochondrial ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100543016 (MRPL22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mgp03011]
    100543016 (MRPL22)
Ribosome [BR:mgp03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    100543016 (MRPL22)
  Bacteria
    100543016 (MRPL22)
  Archaea
    100543016 (MRPL22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 100543016
NCBI-ProteinID: XP_010717479
Ensembl: ENSMGAG00000005605
UniProt: G1N1U9
Position
15
AA seq 211 aa AA seqDB search
MAARCAGGAGSAWVRGLLGWMRPERWFAAGSFFPLSCIHTSTSLQKLGKWEKKNRIVYPP
QLPGEPRRPAEIYHCRREIKYSKDKMWYLAKLIKGMSIDQALAQLEFNDKKGAKVIKEVL
LEAQEMAVKNHNVEFKSNLYIAESLAGKGHYTKRIRYHGRGMFGIMKIVKCHYFVKLVEG
LPPPPEPRKTGFDQAKEYVQQLRNRTLVHTL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcgctgcgcgggaggtgcaggtagcgcctgggtgcgggggctcctcggctgg
atgcggccggagaggtggtttgcagctggtagctttttcccgctgtcgtgcatccacaca
agtacatccctgcagaaacttgggaagtgggagaaaaagaacaggattgtttaccctcct
cagctgcctggggaacctcggagaccagccgaaatatatcattgtcggagggaaataaaa
tacagcaaagataagatgtggtatctggcaaaactgattaaaggaatgtccattgatcaa
gctcttgctcagttggaattcaatgataaaaagggagcgaaggtgatcaaagaggttctc
ctagaggctcaggaaatggcagtaaaaaatcacaatgtggaattcaaatcaaatttatat
atagctgagtcactggcaggcaaaggccattatacaaaacggatccgttaccatgggaga
ggcatgtttggcatcatgaaaatcgtcaagtgccactattttgtgaagctggtggaaggg
cttcctcctcctccagagccacgaaagactggttttgaccaagcaaaagaatacgtgcaa
cagctgcgcaatagaacccttgttcacacactgtga

DBGET integrated database retrieval system