KEGG   Meleagris gallopavo (turkey): 100543066Help
Entry
100543066         CDS       T01523                                 

Gene name
NT5M
Definition
(RefSeq) 5',3'-nucleotidase, mitochondrial
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00230  Purine metabolism
mgp00240  Pyrimidine metabolism
mgp00760  Nicotinate and nicotinamide metabolism
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100543066 (NT5M)
   00240 Pyrimidine metabolism
    100543066 (NT5M)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100543066 (NT5M)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     100543066 (NT5M)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NT5C
Motif
Other DBs
NCBI-GeneID: 100543066
NCBI-ProteinID: XP_003210663
Ensembl: ENSMGAG00000004438
Position
16
AA seq 232 aa AA seqDB search
MILLSSILHLRPRHCGPLAGLGRGSGPTAGSRRALRVLVDMDGVLADFEGGFLKKFRARY
PDKPYIALEDRRGFWVSEQYGRLAAELSEKAISIWESKNFFIELDPLPGAVEAVKQMSNL
ADTDVFICTSPIKKYRYCPYEKYAWVEKHFGPEFLEQIVLTRDKTVVSADLLIDDRPDIT
GAEMNPSWEHVLFTACHNKHLQLEPPRRRLQSWSDDWRAILDSKRLPLGHVA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattttgctgagcagcatcttgcacctgcggccccggcactgcggtcccttggcaggg
ctgggcagggggtccggccccacagcagggtcccgcagggcgctgcgcgtgctggtggac
atggatggggtcctggctgacttcgaaggaggattcctcaagaagttcagggccaggtat
cccgacaagccctacattgccctggaggaccggaggggcttctgggtgtcggagcaatac
gggcgcctggcagctgagctgagcgagaaagctatcagcatctgggaatccaagaacttc
ttcattgagctggacccgctccctggcgctgtggaagctgtgaagcaaatgtcaaatttg
gcagacactgacgtgttcatctgcacaagccctatcaagaagtaccgttattgcccttat
gagaagtatgcctgggtggagaagcactttggccctgagtttctggagcagattgttctg
acacgagataagacagtggtttctgctgatctgctcatcgatgacagacctgatataact
ggggccgagatgaatcccagctgggagcacgtgctcttcactgcctgccacaacaagcat
ctgcagctggaaccacccaggcgccggttgcagtcctggtctgatgactggagagccatt
ctggacagcaaacggctgccactgggccacgtggcctaa

DBGET integrated database retrieval system