KEGG   Meleagris gallopavo (turkey): 100544155
Entry
100544155         CDS       T01523                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mgp01002]
    100544155 (ADAMTS13)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100544155 (ADAMTS13)
Peptidases and inhibitors [BR:mgp01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100544155 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin ADAM_spacer1 TSP1_spondin Reprolysin_4 Reprolysin_5 Reprolysin_3 Pep_M12B_propep TSP1_CCN Reprolysin_2 Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 100544155
NCBI-ProteinID: XP_010719266
Position
19
AA seq 1464 aa
MIIGLTIRVLIMLPLGLCWPSILRERFLRALDADDVFSYFGTSSVSDVPEFVVAQLNCPC
KEEQIGLTCRIQRCSIKAWGEVYAFEFLEDHTLLSSSFVISQVVNSSFSLIKRFSGNCFA
GGNLLAPPGAECRVTYCEGQLQGVIVTDEEKIHIRPVRSKDTALLKDFGFSSPHILFRSA
VVGAKTARAGHFASRLQKRADGTVKHLELMVVAGPDVYMYHQEDTERYILANLNIGAELL
RDASLGAHFRVHLMQMLVLREPEVNVSITANITSSLISVCEWSKKVNPQNDSDPQHADIV
LYVTRFDLELPDGNKELRGVTQLGGVCSSSWSCVITQDTGFDLGVTIAHEIGHSLGIPHD
GEGNQCSSSGYIMGSAGNHNSVDLVWSQCSREEFLAFVSTGQTNCLNDLPDMEGSIPGWK
PGLYYGADEQCKIAFGSVATACTFADSNVDMCKALSCHVQPGDKSSCTRLFVPLLDGTEC
GINKWCSKGQCSSLKELNPMAVVHGQWSSWSPLSSCSRSCGGGVRIRQRFCNNPRPAFGG
KECQGASLQAEICNTQACPMTQLDFMAEQCAATNLKPLYLNVGVPSFYTWTSAVGFAKGD
TQCKHMCKAIEDKFMVSREDSFIDGTRCEPDNSEGGTFHLCVAGSCRAFGCDGQMDSRKA
MDSCKVCGGDNTTCMEVSGSYTEGKAKEYVTFLSLPYNATLVRVTNQRPLFAHLAVKVKG
EYVVAGKGKISLNVTYPSVLEDRQIEYRVFLTKDNLPRLEEIRMDGPTQEEIEIQVYRRY
AKEYGDATNPDITFSYFVPKENLTYRWIPQQGPCSVTCGGGTRLVNHVCFDQTKNEITEN
QLCLELLQPLPGYEPCAVEPCPYRWKISQTDECSAVCGSGVAQQKLTCVQFHNGSETVVD
DSLCSAQEKPLSVVPCVVNVCPLGWDKEEDVDLLQPAESPGHIQLENQSVYVWSPLAGEC
SVSCGRGKTQIQYACVAFDTKEKTQEENCHPVAKPESRLEDCNLSPCPPRWHYKMGSCSV
SCGGGVMQKVLYCARETREKEEEIVADSQCDGLPRPEEQELCNLEPCPPRWKVTPGGPCS
SSCGLGLSVQLVTCVQIHQGKEILLEQHSCPVEEKPLTTIPCVIRMCSYEWSFSEWTECS
TSCGNGVQTRHDFCLNRLTHKHVSPIFCRHFPKAIVLRGCSAGPCPEQGVSTRLHATELQ
AVTPAMHLMTTANAEGARYKGLILPSSALPAVPQERMKETSEGICGKLFLNTSGVINMTG
VGSSDCTVAIGRPLGEEITINVLESSLNCSAGEVLLLSGRMMWRMGCRKLTLSLINSRTN
TLIVKQRVLLPENGVVLQYNSRNATKKYYQECDKQLFGPHGEIVNPTQSPGQKQEVVCRT
FINVAPQHHIAIRGLYVDQSHESNQTNFNYILIRDVSTMKTMVFRGKQQFFWQSTGSQAE
IEFHENVKDHQTSFWAEYHAAEPK
NT seq 4395 nt   +upstreamnt  +downstreamnt
atgatcatcggtctgaccatccgagtgctcataatgctccctctggggctttgctggccc
tccatcctccgagagagatttctcagagctttggatgcagatgatgttttctcttatttt
ggaaccagctcagtgtctgatgtacctgagtttgttgttgctcagctgaattgcccttgt
aaagaagagcagattgggctgacatgtcggatccaacgctgctccattaaggcctgggga
gaagtgtatgccttcgaatttctagaggaccatacccttctttcctcttcctttgtgatc
agtcaagtggtgaactcttcctttagcttaataaagcgattctcaggcaactgctttgca
ggtggaaatctattggcacctcctggggctgagtgtagagtcacttactgtgaagggcag
ctgcaaggagtcattgttacagatgaagaaaagattcatatcaggcctgtcagaagcaaa
gatactgccctgctgaaggattttggcttctccagtccccacattctcttcagaagtgct
gtagtaggggcaaaaacagcaagagcagggcactttgcttctcgcctacaaaagagggct
gatggaactgtcaaacatctggagctgatggttgtagcaggtcctgatgtttacatgtac
caccaagaggacacggagcgatatattcttgccaacctgaacattggggcagaactgctg
cgagacgcctcactgggggctcatttcagggttcatttgatgcaaatgcttgttttgaga
gagccagaggtgaatgtgagcatcacagcaaatatcacctcctcgctgatcagtgtttgt
gagtggagcaagaaggtcaacccccagaacgactctgatccccagcatgctgacattgtc
ctgtatgtgaccaggtttgacctggagttacctgatgggaacaaggagctacgtggagtg
actcagttaggtggggtctgctcctcctcctggagctgtgtcattacccaggacactggc
tttgacttgggagtcaccatagcccatgagattgggcacagtcttggcatcccccatgat
ggtgaggggaatcagtgcagcagcagtggttacatcatgggttcagcagggaaccataat
agcgttgacctcgtctggtcgcagtgtagccgagaagaattcctggcctttgtcagcaca
ggccaaacaaactgcttaaatgacctgccggacatggaaggcagcatccctggatggaag
cctggcttgtactatggagcagatgagcaatgtaaaatagcctttgggagtgttgcaacc
gcgtgcacctttgctgacagcaatgttgatatgtgtaaagctctctcatgccatgtacaa
ccaggagacaaatccagctgtacccggctttttgttcccctcttggatggtactgagtgt
ggcatcaataagtggtgctccaagggacagtgcagctctctgaaagaactaaatcccatg
gctgtagtccatgggcagtggtccagctggagcccgttgtcctcctgctcccgcagctgt
ggaggtggagttcggataaggcagcggttctgtaataaccccaggcctgcttttggaggg
aaggagtgccagggtgccagccttcaagcagagatatgcaatactcaggcctgtccgatg
acccagcttgactttatggctgaacagtgtgcagcaacaaatttaaagccactatatctc
aatgtaggagtgccatccttttacacctggacttctgctgttggctttgccaaaggggac
acgcagtgcaagcacatgtgcaaggcaattgaagataaattcatggtaagccgtgaggac
agtttcatagatggaaccagatgtgagcctgataactctgaaggtgggactttccatctg
tgtgtagcagggagctgcagagcattcgggtgtgatggccaaatggactccaggaaggca
atggactcttgcaaggtctgtgggggtgataataccacctgcatggaagtgagtggatct
tacacagaaggaaaagctaaagagtatgttacatttttgtccctgccttacaatgccacc
ttagtccgtgtcaccaatcagagaccgctcttcgcacatttggctgtgaaggtaaaaggt
gaatacgtggttgctggaaagggaaaaatctcattgaatgtcacctatccctcagttctg
gaggacagacagatcgaatacagagtgtttctcaccaaggacaacctgccacgcctggag
gaaatccgtatggatgggccaacacaagaagaaattgaaatacaggtttatagaaggtat
gcaaaagaatatggtgatgccaccaacccggacatcaccttcagctactttgtgccaaaa
gagaatctgacatacaggtggattcctcagcaggggccgtgttcagtgacctgtggagga
ggtacacgactggtgaaccacgtgtgctttgatcagacgaagaatgaaataacagaaaat
cagctgtgtctggaactcctacaaccccttccagggtatgaaccctgtgctgtggaacca
tgcccatacaggtggaagatatctcagacagatgaatgttctgctgtctgtggaagcggt
gttgcccagcagaagttgacctgtgttcagtttcataatggatcagagactgttgtggat
gacagcttatgttctgcacaagaaaaaccactctctgttgtgccgtgtgtggttaatgtc
tgccctttgggatgggacaaagaggaagacgtggatttgcttcagcctgcagagtcacct
ggacatatccaactggaaaatcagagtgtttatgtctggagccctctagctggagagtgt
tcagtgtcctgtggtagaggtaagactcagatacagtatgcatgcgtggcttttgacacc
aaagaaaaaacccaagaagaaaactgtcatccagtagcaaagccggagagcaggttggaa
gactgcaatctcagtccctgcccaccgaggtggcattacaaaatgggctcatgcagtgta
agctgtggaggaggcgtgatgcagaaggtcctctactgtgcaagggaaaccagagagaag
gaagaagagattgtggcagacagtcagtgtgatggtttgcctcgtccagaggagcaggaa
ctgtgtaacttggagccatgccccccaagatggaaggtaaccccaggtggcccctgttcc
tccagctgtgggcttggcttatctgttcagctggtcacctgtgtgcagattcatcaaggc
aaagagattttgctggagcagcattcatgtcctgtggaggagaagccccttaccaccatt
ccctgtgtcatccggatgtgttcttatgaatggagcttcagtgaatggacagagtgttca
acctcatgtggaaatggtgttcagacacggcacgatttctgcctcaaccggctaactcat
aagcacgtgagccccatcttctgcaggcacttccccaaggccatcgtgctgcgtggctgc
tctgcagggccctgtcctgagcagggggtgagcaccaggctgcatgcaacagaactgcag
gcagtgacaccagccatgcatctgatgactactgcaaatgctgaaggggcaagatacaaa
ggcctgattcttccttcatctgctctgccagctgtccctcaggaacggatgaaggagacc
agtgaaggcatctgtggaaagctctttctaaataccagtggggtcatcaacatgacaggt
gtagggagcagtgactgcactgttgctattggacgtcctctaggagaggagatcacaatc
aatgttctggagagctccctcaactgcagcgcaggtgaggttctgctgctttccggacga
atgatgtggcggatgggctgcaggaagcttactttgtctctgataaattccagaacaaat
accttgattgtgaaacagcgtgttctgctgccagaaaatggggtcgttcttcagtacaac
agcagaaatgcaaccaaaaaatattaccaagaatgtgacaagcagctgtttggtccccat
ggtgaaatagtgaatcctactcaatcacctggtcaaaaacaagaagtggtgtgtcggacc
ttcatcaatgtggctcctcagcatcacatagctatccgaggcctgtatgttgaccagagc
cacgagagcaaccaaacgaactttaattacatcctgatccgtgatgtaagcaccatgaag
acaatggtgtttcgtgggaaacagcaattcttctggcaatcaacaggaagccaagctgaa
attgaatttcatgaaaacgttaaggatcaccaaaccagtttctgggctgaatatcatgct
gctgaacccaaataa

DBGET integrated database retrieval system