KEGG   Meleagris gallopavo (turkey): 100544448Help
Entry
100544448         CDS       T01523                                 

Definition
(RefSeq) cytochrome P450 2C9-like
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00140  Steroid hormone biosynthesis
mgp00590  Arachidonic acid metabolism
mgp00591  Linoleic acid metabolism
mgp00830  Retinol metabolism
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100544448
   00590 Arachidonic acid metabolism
    100544448
   00591 Linoleic acid metabolism
    100544448
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100544448
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100544448
Cytochrome P450 [BR:mgp00199]
 Cytochrome P450, animal type
  CYP2 family
   100544448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100544448
NCBI-ProteinID: XP_010712714
Position
8
AA seq 494 aa AA seqDB search
MLLLGAASVVLLVCVACLLSIVQWRKRSGKGKMPEGPAPLPIVGNILQVKPKNLAKTLEK
LSEKYGPVFSVQLGSTPVVVLSGYEVVKEALIARADEFAARGHMAIGDRANKGLGIIFSN
NEEWLQVRRFALTTLRNFGMGKRSIEERIQEEAEHLLEEITKTKRMPFDPTFKLSCAVSN
VICSIVFGKRYDYKDKKFLSLMNNMNNIFEMMNSLWGQFYQMFSYILDYLPGPHNNIFKE
IDALKAFVAEEIKLHQVSLDPSAPQDFIDCFLSKMQEEKDNPKSHFHMKNLITSTFDLFI
AGTETTSTTVRYGLLLLLKYPKIQEKVQEEIDRVVGRSRRPCVADRTQMPYTDAVVHEIQ
RFITLIPTSVPRAVTKDIRFRDYVIPKGTTVFPLLSTALYDSKEFPNPTEFNPGHFLNQN
GTFRKSEFFIPFSAGKRICPGEGLARMEIFLLLTAILQNFTLKPVISPEELNITPTLSGT
GNVPPYYQLCAVPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcctgggagcagcgagcgttgtcctcctggtttgtgttgcttgcctgctctcc
attgtgcaatggagaaaaaggtctggaaaggggaagatgcctgagggaccagctcccctt
cccatcgtagggaacatactgcaggtgaaaccaaagaatttagccaaaactcttgagaag
ctctctgaaaaatatgggccggtcttctcagtgcaactgggttcaactccagtagtggtg
ctgtctggatatgaggtggtgaaagaagccttgatagctcgtgcggatgagtttgctgcc
cgaggacacatggctatcggggaccgggctaataaaggattaggcattattttcagcaac
aacgaggaatggttacaagttcggcggtttgctctcaccactctgcgcaactttgggatg
gggaagaggagcattgaagagaggatccaggaggaagctgagcacttgcttgaagagatc
acaaaaacaaagagaatgcccttcgacccaacattcaagctgagctgcgctgtctccaat
gtcatatgctccatcgtctttgggaaacgatacgattataaagacaaaaagttcctgtcc
ctgatgaacaacatgaacaacatatttgaaatgatgaattccctctggggacagttttac
cagatgttctcctacatcctggattatttgcccggaccacacaacaatatattcaaggaa
attgatgctttaaaagcctttgtggcagaggagataaagctgcaccaagtctccctggat
cccagcgccccccaggatttcattgactgtttcctcagcaaaatgcaggaggaaaaagac
aatcccaaatcacacttccacatgaaaaacctgatcacctcgacctttgacttgttcatt
gctggaacagagacaacaagcaccactgtacgatacggacttctgcttcttctcaaatat
ccaaagatacaagagaaagttcaagaagagattgatcgggtagtaggacgatcacggaga
ccttgcgtggctgaccggacccagatgccctacacagacgcagtggtccatgaaatccag
cgcttcatcaccctcatccctacaagcgtccctcgagctgtcaccaaagacatccgcttc
agagactacgtcattcccaagggcaccacagtctttcccctcctcagtactgcactgtac
gacagcaaggagtttccaaacccaactgagtttaatcctggacatttcttgaaccagaat
ggcacctttaggaagagcgagttcttcattcccttctcagcagggaaacgaatttgcccc
ggagagggcctggcacgcatggagatattcttactcttgaccgccatcctgcagaacttc
accttgaagcctgtcatcagccctgaggaactcaacatcaccccaacactgagtgggaca
ggaaatgttcctccctactaccagctctgtgccgtcccccgctga

DBGET integrated database retrieval system