KEGG   Meleagris gallopavo (turkey): 100544492
Entry
100544492         CDS       T01523                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00230  Purine metabolism
mgp00240  Pyrimidine metabolism
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100544492 (DCK)
   00240 Pyrimidine metabolism
    100544492 (DCK)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100544492 (DCK)
SSDB
Motif
Pfam: dNK AAA_28
Other DBs
NCBI-GeneID: 100544492
NCBI-ProteinID: XP_010708129
Ensembl: ENSMGAG00000009956
Position
4
AA seq 165 aa
MLFSTAAGKSTFVDILKQADEGWEVVPEPVARWCNVQQNSEEDCEELTTSQKSGGNVLQM
MYEKPERWSFTFQMYACLSRIRAQLKSIDGKLREAENPVVFFERSVYSDRYIFAANLYES
DCMNETEWTIYQDWHDWMNKQFGQSLALDGIIYLRATPEVRNKNL
NT seq 498 nt   +upstreamnt  +downstreamnt
atgcttttttctacagctgctggaaaatcaacatttgtggatattctcaaacaagctgat
gagggatgggaagttgttcctgagcctgtagctagatggtgcaacgttcaacaaaactct
gaagaggattgtgaggaactgactacgtcacagaagagtggtggaaatgtgcttcagatg
atgtatgagaaaccggagaggtggtctttcactttccagatgtacgcgtgtctcagcagg
attcgggctcagctcaaatccattgatggcaaactcagagaggcagaaaatcctgtggtg
ttctttgagcgatctgtctacagtgatagatatatctttgcagctaatttatatgagtct
gactgtatgaatgaaactgagtggactatttaccaagactggcatgactggatgaataag
cagtttggtcaaagcctagcactggatgggattatttatctcagagccactcctgaggta
aggaataagaatttatga

DBGET integrated database retrieval system