KEGG   Meleagris gallopavo (turkey): 100545142Help
Entry
100545142         CDS       T01523                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV-like
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04020  Calcium signaling pathway
mgp04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100545142
   04020 Calcium signaling pathway
    100545142
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100545142
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100545142
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   100545142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1 YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 100545142
NCBI-ProteinID: XP_010723310
Ensembl: ENSMGAG00000004031
Position
30
AA seq 337 aa AA seqDB search
MPPSCRGATSVVYSCEEKGTRTPYAAKILKKTIDKKIVRTEIGVLLRLSHPNIIKLKEIF
ETPSEIALVLELVTGGELFDRIVERGFYSERDAAHVVKQILEAVLYLHENGVVHRDLKPE
NLLYADLSPDAPLKIGDFGLSKIVDEQDTMKTVCGTPGYCAPEILHGCPYGPEVDMWSVG
VITYILLCGFEPFFDPRGDQYMYSRILTCDYEFVSPWWDEVSLNAKDLVRKLIVLDPQKR
LTVYQALEHPWVTGKAAKFAHMDSTQKKLQEFNARRKLKAAMKAVVASSRLGNHGHHDCS
RSRGGSRGGTEATAASEELEAFPAVPKVPINGASCRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcctgcaggggagccacctctgtggtgtacagctgtgaggagaagggcaca
cgtaccccatatgctgccaagatcctgaagaagacaatcgacaaaaagattgtgaggacg
gagatcggggtcctgctgcgcctctcacaccccaacattatcaaactgaaggagatcttc
gagacgccctcggagatcgctctggtgctggaattggtgacgggaggagagctcttcgac
aggatcgtggagagggggttctacagtgagcgggatgcagcccacgtggtcaagcagatc
ctggaggctgtgttgtatttgcatgagaacggagtggtgcaccgggacctgaagccggag
aacctgctgtatgcagacctgtcccccgacgcccccctgaagatcggtgacttcgggctc
tccaagatcgtggatgagcaggacaccatgaaaactgtctgtgggacaccggggtactgc
gcccctgaaatcctgcacggctgcccctatggccctgaggtggatatgtggtcggtgggt
gtcatcacctacatcctgctctgcggcttcgagcccttctttgacccacgtggggaccaa
tacatgtacagccgcatcctcacctgtgactacgagttcgtgtccccgtggtgggacgag
gtttccctcaatgccaaggacctggtcagaaaactgatcgtcttggatccccagaagaga
ctgacggtctatcaggctctggagcatccctgggtgactggaaaagcagccaagtttgcc
cacatggacagcacacaaaagaagctgcaggaatttaacgccaggaggaaactgaaggct
gccatgaaagccgtggtggcatccagccgtttgggcaaccacggccaccacgactgctcc
aggagccgggggggctcccgggggggcactgaggccaccgctgcatccgaggagctggag
gcgttccctgctgtgcccaaagtgcccatcaacggggcgagctgcaggagctga

DBGET integrated database retrieval system