KEGG   Meleagris gallopavo (turkey): 100545503Help
Entry
100545503         CDS       T01523                                 

Gene name
ERLIN2
Definition
(RefSeq) ER lipid raft associated 2
  KO
K23341  erlin
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mgp04121]
    100545503 (ERLIN2)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    100545503 (ERLIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346 POR_N
Motif
Other DBs
NCBI-GeneID: 100545503
NCBI-ProteinID: XP_010721409
Ensembl: ENSMGAG00000001925
Position
24
AA seq 342 aa AA seqDB search
MAQLGAIAALVLSFLAAAFLSAIHKIEEGHIGVYYRGGALLTSTSGPGFHLMLPFITSYK
SVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLIQSAVYDIVKNYTADYDKALIFNKI
HHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLTTMAPGLIIQAVRVTKPNIPETIR
RNYELMESEKTKLLIAAQKQKVVEKEAETERKKALIEAEKIAQVAEITYGQKVMEKETEK
RISEIEDAAFLAREKARADAECYTAMKVAEANKLKLTPEYLQLMKYKAIAANSKIYFGKD
IPNMFMDYAGSQSKFAEGLAEGIHEEDGAGPSEDTKLLHNTN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctgggcgccatcgccgctctcgtcctcagcttcctcgccgccgccttcctc
tccgccatccataagatcgaggaaggtcacatcggagtctactaccgcggcggcgcgttg
ctgacctccaccagcgggccgggttttcacctcatgctgcccttcatcacgtcctacaag
tcagtgcagaccacgctgcagaccgatgaggtgaaaaacgttccgtgtggtacgagtgga
ggagtgatgatttacttcgacagaattgaggtggtgaatttcctgatccagagtgcagta
tatgacatagtgaagaactacactgctgactacgacaaagctctcatcttcaacaagatt
caccatgagcttaaccagttctgcagtgtccacacactccaggaggtctacattgagctg
tttgatcagattgatgaaaaccttaaactggcattgcagcaagacctaactacaatggcc
cctggattaattatacaggcagttcgagttacaaagccaaacatccctgaaacaatccgg
aggaattatgagctcatggagagcgagaagacaaagctgctgattgcagcacagaagcag
aaggtggtggagaaggaagcagagacagaaaggaagaaagccctcattgaggcagaaaaa
atagcacaagttgctgaaataacctatggacagaaagtgatggaaaaagaaacagagaaa
cggatttcagagattgaagatgctgcgtttcttgcaagagagaaggcaagagctgatgct
gaatgctatactgctatgaaagtagccgaagctaacaagctgaagttaactcccgagtac
ttgcagctgatgaaatacaaggctattgcagcaaacagcaagatttattttggcaaagat
attcccaacatgttcatggactatgcaggtagccagagtaaatttgcggagggactggca
gaaggaatccatgaagaggatggagcaggacccagtgaggacacaaaactgcttcataac
accaactga

DBGET integrated database retrieval system