KEGG   Meleagris gallopavo (turkey): 100546205Help
Entry
100546205         CDS       T01523                                 

Gene name
NMNAT3
Definition
(RefSeq) nicotinamide nucleotide adenylyltransferase 3
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00760  Nicotinate and nicotinamide metabolism
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100546205 (NMNAT3)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     100546205 (NMNAT3)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     100546205 (NMNAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like DUF1852
Motif
Other DBs
NCBI-GeneID: 100546205
NCBI-ProteinID: XP_010714755
Position
11
AA seq 273 aa AA seqDB search
MSVKSRIPLILLACGSFNPITNMHMRLFELARDHLHQTGRYQVIEGIMSPVNDDYRKKGL
VSARHRIAMAKLALETSDWIRVDPWETEQESWTETVKVLRHHYNELQSKKEFMKNKQPTE
RSTENFLSSQCSALPELKLLCGADFLQTFQTPNLWKKEHIQEILEQFGLVCISRAGSDPA
QYINESELLTKFQHNIFLVKEWIQNEISSTQIRYALSRGLSVKYLIPDSVIAYIAYHNIY
TEESEQKNEGDLLQPLKLHNTAVTSLLNDMERY
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgaagagcaggatacctctcattcttctagcttgtggctcctttaatcccatc
acaaatatgcatatgcgtttatttgagctggctagagatcacctgcatcaaacaggaaga
taccaagtgattgaaggcataatgtctcctgtcaatgatgactacagaaaaaaaggcttg
gtttcagcaaggcatcggatagcaatggccaagctagcactggagacatctgactggatt
cgagttgatccatgggagactgagcaggagtcatggacagagacagtaaaagtgttaagg
caccattacaatgagctccagtccaagaaggaattcatgaaaaacaaacagcccacagaa
agatctacagagaatttcctttcttcccagtgctcagctctaccagaactaaagctcctc
tgtggggctgattttctgcagacatttcagacacccaatctctggaagaaagagcacatc
caagaaatcttagaacagtttggtttggtctgtataagccgtgctggctctgatcctgct
cagtatatcaatgaatcagaacttctaactaaatttcagcacaatatctttctagtgaaa
gaatggattcagaatgaaatcagttcaacacagatacgctatgccttgtccagaggatta
agtgtaaaatacctcataccagattctgtcatagcctacattgcttaccataatatctac
acagaagaaagtgaacagaagaatgaaggtgacttgcttcagcctctgaaattgcataat
acagcggtgacttcacttttgaatgatatggaaaggtattaa

DBGET integrated database retrieval system