KEGG   Meleagris gallopavo (turkey): 100546581
Entry
100546581         CDS       T01523                                 
Symbol
BARX2
Name
(RefSeq) homeobox protein BarH-like 2
  KO
K09361  BarH-like homeobox
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mgp03000]
    100546581 (BARX2)
Transcription factors [BR:mgp03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    100546581 (BARX2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN DUF5304
Other DBs
NCBI-GeneID: 100546581
NCBI-ProteinID: XP_003212719
Ensembl: ENSMGAG00000001019
Position
26:1389805..1417401
AA seq 258 aa
AKAGRRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLLVRPKPLHSCAGSPSLRAYPLIS
VITRQPSVVPHLVPAATSSHVLPAQTSATASSETPASETHGSSESEAEQPTPRLKKPRRS
RTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGG
QEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQSQEAEGSQAPEEPKVAEEKPEVSLETE
KSPEHIPEPSSEEATPLS
NT seq 777 nt   +upstreamnt  +downstreamnt
gccaaggcaggcaggaggcgctacaagactttcatgatcgacgaaatcctctccaaggag
acgtgcgattacttcgagaaactttctctctattccgtctgtccgtccctcctggtccgg
cccaagccgctgcactcctgcgcggggtccccttctctgagggcatatcctctcatctcc
gttatcaccaggcagccctctgtggtccctcacctcgttccagctgccaccagctcccat
gtgctgccagcccagacctcagcgactgcgagctcagagacgccagccagcgagacccac
ggcagcagcgagtcagaggcagagcagcccacacctcggttaaaaaagccacgccggagt
cggaccatcttcacagagctccagctgatgggcttggagaagaaattccagaagcagaag
tatttgtctacacctgacaggctcgacttggcgcagtcgctggggctgacccagctccag
gtgaagacatggtaccagaaccgcaggatgaagtggaagaaaatggtgttgaaaggtggg
caggaagctccaacaaagcccaaaggccgtccaaagaaaaactccattcccacctcagag
gaaattgaagcagaagagaaaatgaacagccaggctcagagtcaggaggcggagggatct
caagcccccgaggagcctaaagtggcagaagagaagccagaagtctctttggagacagaa
aagtctccagaacatataccagagccctcctcagaggaggctacgccattaagttaa

DBGET integrated database retrieval system