KEGG   Meleagris gallopavo (turkey): 100546807Help
Entry
100546807         CDS       T01523                                 

Gene name
TTN
Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100546807 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100546807 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mgp04812]
    100546807 (TTN)
   04147 Exosome [BR:mgp04147]
    100546807 (TTN)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100546807 (TTN)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100546807 (TTN)
Membrane trafficking [BR:mgp04131]
 Others
  Actin-binding proteins
   Others
    100546807 (TTN)
Cytoskeleton proteins [BR:mgp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100546807 (TTN)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100546807 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N C2-set_2 fn3_2 Ig_6 Receptor_2B4 C1-set Pkinase Titin_Z fn3_4 Ig_5 Izumo-Ig Pkinase_Tyr Ig_C17orf99 Ig_4 PPAK THB Kelch_1
Motif
Other DBs
NCBI-GeneID: 100546807
NCBI-ProteinID: XP_019472906
Ensembl: ENSMGAG00000016742
Position
7
AA seq 33577 aa AA seqDB search
MTTKAPTFTQPLQSVVALEGSAATFEAHISGFPVPEVSWYRDGQVLSAATLPGVQISFSD
GRAKLVIPSVTEANSGRYTIQATNGSGQATSTAELLVTAGTAPPNFSQRLQSMTARQGSQ
VRLDVRVTGIPTPVVKFYRDGVEIQSSPDFQILQEGDLYSLIIAEAYPEDSGTYSVNATN
NVGRATSTAELLIQGEEEAVPAKKTKTIVSTAQISQTRQARIEKKIEAHFDARSLTSVEM
VIEGATAQQLPHKAPPRMPPRPTSKSPTPPVITAKAQMARQQSPSPVRQSPSPVRHVRAP
TPSPVRSVSPAGRISTSPIRPVKSPSPIRKAQVVTPGAEVLPPWRQEGYSATTEAQMKET
RVSTSATEVRTEERWEGRYGLQEQVTISGAAAGEVAAGAKEVRRDSEKTAAVATVVAAVD
QAMVREPAPSVVEQAAKRTAMTAVHVQPVQEQMRKEATVVVTSDKATKQTVISRTREGIV
TSQEQRHISREKVRKEPEKTPVPTVIIATDKAKEQERISTAREEISVRHEQVHVSHEQIR
REDVKPSVPKVVITTDKPKAPVLISKSKEGIATKQERVSISHEKIKKEAKKTTVVPKIIA
PVTVPRTREEITAKQEQMHLAYDQIEAGKRAEAVATVVAAVDQARVRSPWETEQVDETYV
KQKTLEYGYKEHAVKDHEAQAEHRVATKEVKTVYIPPEKHIPAAEKKEVHVSTEIKRETE
AKIEKTIHIEHPRPRTASPHFTVSKIAVPKPDHTYEVSIAGSAMATLEKELSAASAAQKI
TKPVKPPQLKPHEVKIKPESAPPQFPFTEVAETKKEVDVSIKGEAVREDHLLLRKESEAK
VTETARVPVPAEIPVTPPTLVWGLKNKTVTEGESVTLECHISGHPQPTVTWYREDYKIES
SMDFQITFKAGLARLVIREAFAEDSGRFTCTATNKAGSVSTSCHLHVKVSEETETRETIS
EKVVTEEKSYVETKDVVMEDVSAAAEEVSGEPVPPFFIRKPVVHKLIEGGSIIFECQVGG
NPKPHVLWKKGGVPLTTGYRYKVSYKRETGECKLEISMTFADDAGEYTIVIRNKFGEASA
TVSLLEEADYEAYIKSQQEMMYQTQVTAYVQEPKVAEVAPPISYGDFDKEYEKEQALIRK
KMAKDTVVVRTFVEDEEFHISSFEERLIKEIELRIIKTTLDELLEEDGEEMMVDISESEA
TEAGFDLRLKNYRTFEGTGVTFHCKTTGYPLPKIAWYKDGKRIRHGERYHMEVLQDGSAS
LRLPVVLPEDEGIYTVFASNMKGNAICSAKLYVEPLAPTAAPGYMPGPEVMRRYRSISPR
SPSRSPARSSPSRSPARRLDETDEGQLERLYKPVFVLKPTSVKCSQGQTARFDLKVVGRP
MPETYWFHNGQQVVNDYTHKIVIKEDGTQSLIIVPAMPEDSGEWAVIAQNRAGKASVTVT
LSVEAKEDLVRPRFVERLKNVSVKEGSRLHMSVKATGNPNPDIVWLKNSDIIVPHKYPRI
KIEGTKGAAALKIESTVRQDAAWYTATAINKAGRDTTRCKVNVEVEHAEPEPERRLIIPK
GTYKAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKQFGPAHFEC
RLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGVITCRATNKYG
TDHTSATLIVKDEKSLVEESQLPEGRRGMQRIEELERMAHEGALPAVAVDQKEKQKPELV
LVPEPARVLEGETARFRCRVTGYPIPKVNWYLNSQLIRKSKRFRLRYDGIHYLDIVDCKS
YDTGEVKVTAENPEGFIEHKVKLEIQQREDFRSVLRRAPEPRHEPVVTEPGKLLFEVQKI
DKPAEATTKEVVKLKRAERITHEKLSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDE
SYEEMLKKTKEELLHWTKEIPEEEKKALPPEGKITIPTFKPEKVELSPSMEAPKIFERIQ
SQTVAQGTDAHFRVRVVGKPDPECQWFRNGVQIERTDRIYWYWPEDNVCELVIRDVTSDD
SASIMVKAVNIAGETSSHAFLLVQAKQLISFIQNLQDIVAKERDSMATFECETSEPFIKV
KWFKNGIEIHSGEKYRMHSDRKAHFLSVLAVEMSDADDYSCALVEDESVKTTAKLTVEGA
VVMFIKELEDVEIPESFTGELECEVSPEDIEGKWYHGDVELSSNHKYVLASRRGRRILTI
KDVNKDDQGEYSFVVDGKRTHCKLKIKPRPMTILEGLTDQKVCEGDIVQLEVKVSLENVE
GVWMKDGHEIQSSDRIHIVLDKQSHMLLIEDATKEDGGTYSFSIPGLELSTTGQVTVYSV
EIIVPLKDVHVVEGTKAILECKVSAPDVTSSKWYLNDHQIKPDERVQAVCKGTKQRLVVT
RTHASDEGHYKLMVGKVETSCNVTVEEIEIIRGLRDITCTETQNVSFEVELSHSGIDIIW
HFKGQEIKAGPKYKIEVHGKIYKLTVVKMMKDDEGEYVFYAGGKKTSGKLIVAGGAISKP
LTDLTVAESQRAVFECEVANPESEGQWLKNGKPLPRTDQYRAETDGVKRRLNIPATKMDD
MGEYSYEIASSKTSAKLHVEAVKIKKTLKNLTVTETQEAVFSVELSHPDVKGALWIKNGV
ELESNDKYEISVKGTVHTLKIKHCVVTDESVYSFKLGKIGANARLHVETVKIIKKPKDVT
ALENAVVSFELSVSHDTVPVRWFHKNVELKQSDKYKMISQRKVHKLMLHNISPADAGEYT
AFVGQLECKAKLFVETIHITKTMKSIEIPETKTASFQCEVSHFNVPAVWLKNGVEIEMSE
KFKIVVQGKLHQLNIMNTSSEDSAEYTFVCGNDRVSATLTVKPILITSMLEDINAEEKDT
ITFEVTVNYEGISYKWLKNGVEIKSTDKCQIRTKKLTHSLSIRNVHFGDAAEYSFVAGKA
ASSATLYVEARHIEFRKHIKDIKVVEKKRAIFECEISEPDVQVQWMKDGQELQIGDRMKI
QREKYVHRLIIPSTKMSDAGQYTVVAGGNTSSANLIVEGRDIRIRSIRKDIQVIERQRAE
IEFEVNEDDIEPQWYKDGIEINFHYEERYSYVVERRIHRMSIFETTYSDAGEYTFVAGRN
RSSVVLYVNAPEPPQIIQELQPTTVESGKPARFCAVISGKPQPKVSWYKDDQQLSPGFKC
KFLHDAQEYTLLLIETFPEDSAVYTCEAKNDYGVATTSASLSVEIPEVVSPELEVPVYPP
AVIVPLRDAVTSEGQSARFQCRVTGTDLKVSWYSKDREIKPSRFFRMTQFEDTYQLEIAE
AYPEDEGTYTFVATNSVGQVTSTATLKLEGFKKVEELTAESHWHVSSSVSLKEETIGQRP
IFIQPISCCRVCSGETVRFQARVSGMPKPEIQWFHNQQLMLPAKDLVFHFDEFTGTVMLI
IVDAFLEHAGQYSCKARNSAGETTCTATLTVTAEVQALDRQSSGKDVKESMRSQAISELH
VTPFTKKNMKAFRKEFQSMQQPSQESGVQVFKSISERLTMKATSVEEEEAMHTTVLSQTS
QSTRISMSTAQEPKGVPPAILLQLRDLTVKSGDIAQFICALENEYFSEFLWAHEGKRIEV
SEKLKISQNGSVLQLTILNAQLIDQGLYSCTIYNDYGGTTTAAILTVKGAPEKIMYEKLE
EEIEMEMKDISSSLTVSSEEGRSEGYSSSLQLPDREKTLEFESEKPVYSSQNNQKMEEGG
SAPVFLRQVSDVEVWQGDVARLSVTVTGSPTPKIQWFFNGVKLTPSTDCKLVFAGSDHSL
ILPYAGMQDEGKYTCTASNVHGEATCSAHLHVQQRAQGAPCFARVPDSVQCAPGFTAVFE
YTVAGEPCPDVEWFKGNEQLFLDARSFVAHHPDGSGSLTVQECTEEDAGLYICRAVNSLG
EAACSAELLVLPEEHLVCKQSPALQHSMVTEDQSPMSYEEVSELPTAERALSLEAMREPQ
ALLQLQISQMEHMLPKEGILPRLPPTCLAVQGVEEMLTQAATTQENNKLLAELVQTLPGG
PQSVSPEVATETPLPGSLGTVAAQMLLPKEQIIPEELEQTAALKTEVSQALQQVSSTTES
CVMYGDHFEVIEGFQAMQGELKSEPRFPSELACTGGHAVPLENISALEAAEEDFAARICE
GQAVRFPLLLEEKQPLEEEHVVNLASPLKQYPKVGRQPREMMYASQFQTSQAFTKESQLT
YQVPKSCHLDMKSQIRDALKAAVVSEQNLLFSEWLADKRSVEVQTLKITKEHKYALCTYV
VTTGGLNPIEIPVSLAEVDIETADQKKVLKEAFYSLIYEEKHLLTDEKPKALPSPPHSLY
SGKSIDETSQPEPQQAERTTEAEIPLEQPLSAEVVNILMEHGQIKDVGAAAATADVAPAG
IPVEKPTEILKRKEKREEIYEEEGREGLETKGVNLEDELSKENYPIIHSKLANTIVEEGE
SVTLVSVVTNVREVNWYFDGKLVSSGNKFKCLQDQDTYKLVISQVCGEIHQGEYTCEALN
QGGKRTTTAKLTVVKRVAPILRRRLEPLEVAVNHMAKFTCEVETTPNVKFQWYKAGREIY
DGDKYSIRSSNYLSMLEIPRPQVVDCGEYSCKASNQHGSVSSTAFLTVTEALPPTFLTRP
ESITTFVGKSAKFLCTVSGTPVIDVAWQKDGTTISSSDHYKISKVENKHVLEISLLTTSD
RGIYTCKASNKFGADVCQAEMVIIDKPHFIKVLQSVQSAVNKKIRLECQVDEDRKVRVEW
TKDGNKIPPGKDYKIFFEDKIASLEIPLAKLKDSGHYVCIVSNEAGSSSSSASVTVREPP
SFVKKVDPSYLLTPGDSARLQCKIKGSPEIQVSWFKDNKKILESNTHKMSFVNFVAVLDI
SEMKVDDSGSYSCEAVNEVGSDSCTTEVVVKEPPSFVRTLEPAEVVKGTNTVLQCEVAGT
GPFEISWYKDKKQIRSSKKYRLTSQKAVISLEVSSFNSADVGEYECVIANEVGKCICSAT
YVLKEPPSFVKKIENVTALAGDNVTLQAVVKGSEPISVMWMKGKDIIHDDNKVRVTFEHG
LATLQITGVQLSSGGKYTCVAENDAGSQSCFGELAVKEPAKIIEKSEVIQVTAGDPAILE
YTVTGTPELKTKWFKDGKPLPASKKYRISFKNNVAQLKFYAAEMQDSGEYTFEISNDVGI
SSCTTSFTVLDRTLPPFFTKPLKNIDSIISTSCRLDCKISGSLPMTVSWFKQDTEITASA
KYTIHFAEGSASLEIKHLDASDAGVYICRATNSAGSKDSSSTLFIKEPPSFIAEPESQDV
LPASTVRFKGTFKGTTPLTVKWFKGDTELITGGACYIMTEALASSLELYAVKPNDSGKYI
CKVSNVAGSITSIANLFVKEPAAFTEKLEPTHLVKKGGYAELTCKVTGTPEIKITWFKDD
RELKESDKFRMSFTKSLAVLHLTDVETEDSGEYICEARNDAGKDTCSTIVTVKESPYFRK
EFQSMEVLKDSDVILECEVLGTPPFEVFWVKDDKPVRSSKKHRISTEKSLISLHVFRFDA
SDVGEYQCRVTNDVGSCLCSSEVTLKEPPQFLKRIENISSLRGGTVVFQAAVKGSLPIIV
SWLKDSDEVIEDSNIKMTFVNNIATLLVKSIELKHDGKYFCQAKNEAGIQRCSALLTVKE
PATIVDKAVSIDVTEGDPATLQCKFSGTKDITAKWFKDGKELTLGPKYKISVTDTVSVLK
VLHAEKKDSGEYVFEVHNDVGRSSCSASINVLDLIIPPKFTKKLKKMDSIKGSFVHLECI
VSGSHPISIQWYKDGQEITTSEKHKYSFHDNTAFLEINKLEGTDSGSYTCEATNKAGSNQ
CSGFLTVKEPPYFVEKPQSQEVVPHARVQFKALVKGSTPLQIKWFKDSQELLSGANRSVW
MDDTSSVLELFSARMSDSGNYTCQISNDVGTATCKATLFVKEPPRFIQMPTPVVALREGQ
STTFECHVVGTPEIHVTWYLDGNEMTDEAKYAISFIDGLATLKVTQARVSDSGIYVCEAH
NDAGSESCSIELKVKEPPTFVRELRPTEVVKGLDAMLECEVTGTPPFEVKWLKNNKEMFS
SKKYAISTKESIFTLNVTNCDTSDVGEYQCIISNEVGSCSCSTRLSLKEPASFVKKLENV
TTVLKGTASFQCVVAGAQPLSVSWIKDEKILEDDEYHHITFENNVATLKLTNVDLSHRGR
YTCQAKNESGVEKCFALLFVQEPARIIEKAKSLKVTERDPVTLECTVEGTPELRIKWYKD
GKQLLPSRYYTMSFENNVASFRIEPVSKEDSGTYSFKVENDFGSSTCEAILTVLDQAIPP
LFIKKLTKKDTVLGSSIQMECKVSGSLPISAKWFKDGKEITDSAKYRSLCHENTMSLEIA
NLELTDTANYTCNVSNIAGSDSCSAVLTVKEPPSFLVKPESQQAIPDSMVEFKAILKGTP
PFTVKWFKEDLELVSGPTCFIGIEGSTGFLTLYSVDSSRSGHYTCHISNDVGSDSCTTML
MVTEPPKFAKKLEATKIVKQGDSARLECKVSGSPEMKVVWFRNDHEIVASEKFRTSFIDS
VAVLEMNHLSTDESGDYICEAQNPAGKASCSTKVTVKEPPVFSRKPSPVDMLRGTEVSLE
CEISGTPPFDVTWYKDKRQIRSSKKYKVTAKNYHTSIRILNVEVADVGEYQCKAQNDVGS
DTCFCTMKLKEPPKFVTKINSMTVVVGEPVELQARVEGSQPISVQWLKDKEEIIRESENT
KITFMENIATLHLVHTETSSAGKYICQIRNDAGSRECMATLTILEPAVIVEKAEPMRVTI
GDACTLECKVAGTPELSTGWFKDGKELTSSQKYRITFVNKVSTLKILDTEKEDGGLYTFA
VQNDVGKSSCTASVEVLDRIIPPSFTRKLKETPGVLGSSALLECKVAGSPPISIDWFQNG
MKLVSGEKHNISFTDNLCILEVNSLSNSDTGTYTCKATNVAGSDECSAVLTVQEPPSFER
IPEPLDVLPGTSVTFTGVIRGTPPFKVNWFRGASELVPGDKCNIYLEDSVVELELFDVTP
LQSGEYTCLVTNEAGRANCTTHLTVKEPAVFVKKLSDQYVEPGKPIILEGTYTGSLPISV
TWKKNGHTLAQSHKCSITTTEKSCILEILDSTKEDAGEYTCHVENEAGRDVCEAVVSTLE
PPYFVTHLEPLEVSVGDYTTLQCHVAGTPEITVSWYKGDTKLRSTPEYKVFFKDNIASLT
FNKVVINDSGEYICKAENSVGTASTKALLTVQERKRPPSFARRLKDIEHPVGLPLKLMCR
LNGSEPITVTWHKDGVQLSDDHSVHTSFVDNVAVLQLVQTEMNHSGQYTCTATNAVGTAN
TSARLTVTEPKQAPVFDTKPESIDVPFGESADFECHVTGAQPIQITWSKDGREIRTGGNF
NITFVANTAHLRVLRVGKGDSGQYTCQASNEAGKDFCSAQLTVKEPPKFIKKPEALQFVR
QGDTVQLECKITGTPEIKITWYKNDQALQASNRLHMSFVESTAVLTILDASAEDAGDYIC
EAQNSAGAASCSTSVSVKEPPVFSKVPSPVDTLKGSDVILQCEIAGTPPFEVAWFKDRRQ
VRSSKKFKVTAKHSIASLHILSLESQDTGEYQCKAMNEVGSDTCTCPVKFKEPPRFTKKL
SDTAIFVGEPTALQAVVEGSPPISVVWLKDKGEVIRESENVQMWFMDNIATLEIASAEGA
DVGKYICQIKNDAGMRECSAFLQVLEPAVILEKTEPITVMAGNPFTLECRVGGTPELITK
WYKDGRELRSDRKYQITFFNNISTLKVFSAEKSDRGLYTFEVHNEVGDSSCTSSVDVSDR
LVPPSFSRKLKETNGVLGSSVLLECKVSGTSPMSVAWFQDGNEIVGGEKYEISFLDNICA
LKLNALDVTDTGPYTCVATNVAGSDECSAFLTVQEPPSFVKTPDPQEVLPGSSVTFTSHI
KGSTPFKVTWFRGIRELVPDSTCSISLDESKAQLQLFNVEPGSSGDYACVVTNDAGSASC
TTQLFVKEPAVFMKKLSDFSVEQGKSIVLESIYTGTPPISVTWKRNGMPIAQSQRCSVTT
TDKSGILEIFNSTKSDEGEYTCEVSNEAGGDVCHSLVSILEPPYFITHLDRVEVKIGEPL
VLKCQIGGAPEIKVSWYKEDTKLRSTQAYKMHFKNNVATLAFSTVEDGDIGEYTCKAENS
VGFATSTALLVVKERQLPPTFARKLKDIQETVGAPVTFDCRINGSEPIQVSWYKDGVLLS
DSDNVQSTFLNNVATLQILQTSMAYCGQYTCSAQNALGTASSSAKLLLTEHLQPPFFDIK
PVSIDVALGERATFKCHVTGSAPMRIVWTRDNREIRPGGNYKMMLVENTASLVVLKVGKG
DAGLYTCTASNSVGKDACAAQLAVQEPPRFIKKLDSSRLVKQHDSTRYECKVGGSPEIKV
TWYKGETEIHPSEKYSMSFVDSVAVLEMHNLSVEDTGDYSCEAQNPAGSASTSTSLKVKA
PPAFTKKPHPVQTLKGSDVHLECELQGTPPFQISWYKDKREIRSSKKYKVMSENYLASIH
ILNVDTADVGEYHCKAINDVGSDSCIGSVTLRAPPTFVKKLSDVTVVVGETIELQAAVEG
AQPISVLWLKDKGEIIRESENLWISYSENVASLKIGNAEPTNAGKYICQIKNDAGFQECF
AKLTVLEPAVIVEKPGPVKVTAGDSCTLECTVDGTPELTARWFKDGNELSTDHKYKISFF
NKVSGLKILNAGLEDSGEYTFEVKNSVGKSSCTASVQVSDRIIPPSFTRKLKETYGQLGS
SAVLECKVYGSPPILVSWFHDGQEITSGEKYQATLTDNTCSLKVNGLQESDTGTYSCTAT
NVAGSDECSTFLSVREPPSFLKKPEPLNVLSGANITFTSIVRGSPPLQVKWFRGSVELAP
GHKCNITLQDSIAELELFDVQPLQTGDYTCQVSNEAGKISCTTHLFVKEPAKFVMKVNDL
SVEKGKNLILECTYTGTPPISVTWKKNGIILKHSEKCSITTTETSAILEIPNSKLEDQGQ
YSCHIENDSGQDNCHGAITILEPPYFVTPLEPVQVTVGDSASLQCQVAGTPEMIVSWYKG
DTKLRGTATVKMHFKNQVATLVFSQVDSGDSGEYICKVENTVGEATSSSLLTVQERKLPP
SFTRKLRDVHETVGLPVTFDCGIAGSEPIEVSWFKDNVRVKEDYNVHTSFIDNVATLQIL
KTDKSLMGQYTCTASNAIGTASSSGKLVLTEGKTPPFFDTPITPVDGIIGESADFECHVS
GTQPIRVTWAKDNQEIRTGGNYQISYVENTAHLTILRVDRGDSGKYTCYASNEVGKDSCT
AQLNVKERKTPPTFTRKLSEAVEETEGNELKLEGRVAGSQPLTVSWYKNNQEVHSSPHCE
ISFKNNTLLLHIKSVGQSDAGLYTCKVSNEAGSVLCTSSVVIREPKKPPVFDQPLQPAAT
EEGNTLQLSCHVRGSEPIRIQWLKAGREIRASERCSFSFANGVALLELAAVTKSDSGEYV
CKASNVAGTDTCRSKVTVKEKAAALPAAKKADMEGKLYFVSEPQSIKVMEKTVATFIAKV
GGDPIPNVKWMKGKWRQLNQGGRIIIQQRGDEAKLEIKDTTKTDSGLYKCVAFNQHGEIE
RSVNLQVEERKQEVVEEDVRGKLKRIPTKKKEDEEQTIDILELLKNVDPKEYEKYARMYG
ITDFRGLLQAFELLKQTREEESHRLEIELTEKAQKEDQEFEELVAFIQQRLTQTEPITLI
RDIENQTVLTDEDAIFECEIKINYPEIKLSWYKGTQKLDSSDKYEIKIEGDRHILKIRNC
QLEDQGNYRIVCGPHIASARLTVIEPAVERHLHDTTFKEGNTCTLSCQFSIPNAKSQWYR
NGRPIKIGGRYSTQVSDKVHKLIIKDVRTEDQGQYTCKLDNLETSADLAIEAEPIQFTKS
IQNIVVSEHQSATFECEVSFDDAVVTWYKGPTELRESPKYSFRSEGRCHYMTIHNVTAED
EGVYSVIARLEPRGEARSTAELYLVTKEIKLELKPPDVPDAKVAVPPQKPAEEAAPIPIL
LPLIPPPEEKKPAEKKVPVKKVSKKVVKKGAKEIPPPEAPEILPEKPKEVKITSMARREG
IHEEKMEIYEKPKEVYEEWEEDYGEDHDYYFKEEGYDEEEEEWEETYEKREVAYEEKQII
HEEAVEVPKKPVPERKPPAITAEKKEKKEVTVHKVVKKPVDEKVEITTQRVAEEKLKRAE
VTKKIPPAKPTPMIVEEKVMKKEVPTVERWTVSEEKMSVSVHREEEYSYVTGMLPEEPKR
APPEEKVAVPKREAAPPPKAPEIPKKPVPEEKLPQIPKVEEAPPAKVPAVPKKPVPKEKV
PPAVPKKVEAPPAKVPEVQKRATFEERMLITEEKISIAVPEEIPSPEEPIVEEWSEEETE
EVSVSIHREEVSEVTEEESYYIEEKVTVPKRKEAPPAKVPEKPRRVAPEPEIPAALKEAP
AAKVPEVHKKVTPKEKVPVPVPKKVEAPPSRERPEEVPTFEIAVEEPPSTKVTQVHRKII
TEEKVAVAKKDEAPPKRAVPKKTVPEEKVPVPVSRKVAAPPAKVPEEPKKMIREERVPVA
VPKRKVSPPLEEEEHWAMSEEVSVSLHTKEEISYTVPDVPERAIIEERVPISPPKKMPRP
PAKVPEVRKMVVQKEKVYIEVPQDEEEEEIPQYEEVTKYEKEVIHYEEEVQHYEEVSHYE
EEAPQYEEVPQYEEEEVTREEEEAAYYEEEVPQYEEEEAEIPQYEEEAPPPVRVPEVPKK
AVPEEKIPVLKKKEVPPAKVPEVPKKPEPEKKVQVPKKKEAPPPKVPEVSKKPVQEEKVP
ILVKKKKDLPPAKVPEVPKKPVPEEKVLVPVPKKVEEPPSAKVPEVSKKVPEKKEPVPVH
KKPEPSPAKVPEIPRPAPEEAPTFVPEEEEEEEAIPEIPVKVPEVPKKAVPEEKVHVAVP
KAKKIPPAKVPEAPKKVVPEEKIPIFIPEKEEETIPEKAIPTKVPEMPKKPVPEEKVPIP
KKVPVPPEKVPKVPMKVVPEKKVPVAPPEKVEVPAAKVPEVRKRDVAEEKVPVIVPKPEE
PPPSKVPEISKKPIRKVPAPAPAPVPAAEKYEYAYEEYEKYETYESIEEFEGVQESEEIE
AYEEPEVPERYREIQEQEYELEAEEKEDIYEKYEFREKEEIYEKYEEAYEETYEIPPAIV
PEVPKRPLPEEKVPVPVPKKEAPPAKVPALPKKPVPKEKVLPAVPKKEVVPPSEVPKIDK
SAVLEDKVPILIPKEDEAPLYEGTSVIHLTEQCLIPDMGIFKFMFKQLFVCICLCILSIL
SNLVLYVILKYVKYANIFKEPELYEDLPTEELPAIIPIKPKAPAPKAPAVTKKIVSLKKI
PAAVPKEEAPPPEVPKKPVHKEKIPPSPPKEEASHRKVHEVYEEIYVEEEISTVHRKEEA
SPPGVPAVVKIAPEVPIAVPKKTEPTPVSRKPGSPSKVPEVPTKVIAEEKPVPLSKKPEA
PPTKVPDVPKKIPEEKVPITVPKKPEPTPAKEPEVPKKIEEKIKVIEPKKPEVPPAKVPE
VPKKVVQEEVSVEVPKKPEPPPAKVPEVPKKVVPEEKVHVEVPKKPEPPPPKEPEVPKKI
VPEKKLPEPVAVPEKPEPLPEKAPEVTARTVPEEKVTLETPKKPEFKKPEPPPTKVLEAP
KKVASEEEVPVALPKIPEPLPSEEYEIEKESEVEETEEISVTEVEETLPVEAPEPEKKIP
EKRKPAVPAPVEDIKLAKELLKAPETRKKVVTAKPVEAPQLEPPPAKVPGLVKKPRRIIP
EVTPPPKEEVVLKRVLRKKPEEEEPKPEKEPKPEVKPVPTPVEKIKKPEVSEVPKKKPEI
PVIKKEEKHVPEPPKEPKQAAISVPGPEPKPAVALKSPKPAAEPAPAITTAPVTTPVVGK
KAEAKPTKEETPKGISPVKAKKTPSPADAERRKLRPGSGGEKPPEEPPFTYQLKAVPLKF
VKEMKDIVLKEAESVGSSAIFEVLISPSTAITSWMKDGSNIRESPKHKFIADGKDRKLHI
IDVQLSDAGEYTCVLRLGNKEKTSTAKLIVEELPVRFVKTLEEEVTVVKGQPLYLTCELN
KERSVVWRRDGKIIKDKPGKFALGIIGLSHSLTITDSDDSDAGTYTVTVEDSELSCSSCV
KVVEVIRDWLVKPIRDQHVKPKGTATFTCDIVKDTPNIKWFKGDEEIPAEPTDKTEILKE
GNKIFLKIKNAGPADIGEYSVEIEGRRYPAKLTLGEREVELLKPLEDVTVYEKETANFDT
EISEEDIPGEWKLKGEILRPSPTCEIKAEGGKRFLTLHKVKLEQAGEVLYQALNAVTTAI
LTVKEIELDFAVPLKDVTVPEKRQARFECVLTREANVIWSKGTDILKIGEKFDIIADGKK
HILVINDSQFDDEGEYTAEVEGKKSTARLFVEGVRLKFISPLQDQTVKEGETAHFQFELS
HEDMLVKWYKNDKRLHTSRTVFITSEGKVHKLEMREVTLDDISEIKAVVKDMNTQANLKV
LEADPYFTVRLQDYSALEKDDVTLQCELSKDVPVKWYKDGEELVASSRISIKTDGLRRIL
TIKKAAEGDKGVYECSCGTDKTNCNIGIEPRLIKVERPLYGVEVFVGETARFEIEISEPD
VHPIWKLKGETLTPSPECEILEDGKKHVLILHNCRLDMTGEVSFQAANAKSAANLKVKEL
PLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITSDERFEIISDGTKHALII
KSVAFDDEAKYMFEAEDKRTSAKLIIEGIRLKFITPLKDVTKKERETAVFTVELSHENIP
VVWFKNDQRLHTTKVVSMTDDGKFHTLTIKDLTIDDTSQIRVEAMGKSSEAKLTVLEGDP
YFTGKLQDYTAVEKDEVILQCEISKADAPVKWMKDGKPITPSKNVVIKADGKKRILILKK
ALKKDIGQYTCDCGTDQTSANLNIEDRDIEIIRPLYSVEVIETETARFDIEISEEGVHGN
WKLKGEPLTESPDCEIKEEGKKHFLTLYNVRLDQAGGVDFQAANAKSGAHLRVKPRVIGL
LRPLKDVTVTAGESATFDCELSYEGIPVEWYLQGKKLEPSDKVVTRAEGRAHTLILRDVK
LTDAGEVSLTAKDFRTQANLFVKEPPVEFTKPLEDQTVEEEATAILECEVSRENAKVKWF
KNGEEVHKTKKYDIISEGRVRKLVIHGCTLDDAKTYTCDAKDFKTSCFLNVEPLRVEFLR
PLTDLEVKEKESARFECEISRPGVKVKWFKDGIEIRKGKKYDIISKGAERILVISKCLFD
DEAEYACEAKTARTSGLLTVIEEEAVFTKNLHDLEVNENETVRLICEISKPNAEVTWFKG
DEEVPDGGRFEYISDGRKRILVIRNAHPEDAGKYTCKLPSSSTTGKLTVHELAAEFLTRP
QNLEVLEGDKAEFACSVSKEAITVQWLWGDTVLEPSDKYDIISDGKKRTLVVKDSVIGDA
GKYSVMVGEAKATARLTVIEKLRIVTPLKDQEVNEGQEIIFNCEVNKEGAKEKWYKNGEA
IFDSAKYIIVQKDLVYTLRIRDTQLKDQATYSISLSNHRGEHAESSAALTVLEEDLRIVE
PLEDIETMEKKTVTFWCKVNRLNATLKWTKNGEEITFDKRILYKIDKYKHSLIIKDCGFK
DEGEYTVTAGQDKSVAELLITEAPADFIEHLQDQTVTEFDDAVFTCQLSKEKASVKWYRN
GREIKEGKKYQFEKDGNLHRLIIKDCRLDDECEYSCGVDDRKSRARLFVEEIPVEIIRPP
QDVYEAPGADVIFMAELNKDGVEVKWLRNNMIIIQGDKHQMMSEGKVHRLQVCEIKPRDQ
GEYRFIAKDKEARAKLELAAAPRIKTGDQNLVVDVGKPLTMTVPYDAYPRAEAEWLKGEE
SLPTTTVDTTNDCTTFKIYEAKKSDKGRYKVVLRNKHGQAEAFINVEVIDVPGPVRNLEV
TETYDGEVGLAWQEPESDGGSKIIGYVVERRDIKRKTWIVATDHAENCEYTVTGLQKGGV
EYLFRVSARNRVGTGEPIETERPVEAKSKFDVPGPPQNVEVTDVNRFGATLTWEVPEYDG
GSPITGYVIELRNRASIKWEPTMTTGADELSAVLTDVVENEEYFFRVRAQNIVGVGKPSH
PTRAVKIMDPVERPSPPINLDHSDQTKTSVQLTWEPPLQDGGSPILGYIIERKEEGTDKW
IRCNPKLVPALTFKVTGLKAGSSYYYRVSAENAAGVSDPAEAIGPLTADDPFVGPTMDLS
AFKDGLEVIVPEPIKIRVPITGYPIPTATWSFGDRVLEEGDRVTMKTTATFAELVITPSE
RPDKGIYTLTLENPVSSVSGEINVNVIARPGAPKELKVVDVSRSTVQLSWEPPEDDGGSP
VIDYIIEKREVSRKTWIKVMDHVMDQEFSVPDLIQGKEYLFRVCACNKCGPGEPAYIDEP
INMSAPATVPDPPENVKWRNPTSKGIFLTWEPPKYDGGARIKGYLVEKSQRGTDKWEICG
EPVIETKMEVTKLKEGEWYAYRVKALNRIGASKPSKPTDDIQAIDAKEAPEIFLDVKLLA
GLTVKAGTKIELPAKITGKPEPQITWTKAEKILRPDDRITIETKPDHSTVTITDSKRSDS
GTYIIEAVNSSGRATAVVEVNVLDKPGPPAAFDVSEITNESCLLTWNPPRDDGGSKITNY
VLEKRATDSEIWHKLSSTIKDTSFRATNLIPHKEYVFRVSAENMYGIGEPAQCNPIIAKY
SFDPPGPPTGLKPIEVTKDSVTLTWNEPDEDGGSPITGYWVERYDPEQDKWIKCNKMPVK
DTTFKVKGLTNKKKYKFRVLAENLAGPGKPSKETEPILVKDPIDPPWPPGKPTVKDVGKT
SLFLNWTKPEHDGGAKIESYVIELLKTGTDEWVRVAEGVPTTEHFLKGLMEKQEYSFRVR
AVNKVGESEPSEPSDPVLCKERLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNY
IVEKRDVRRKGWQTVDTTVKDTKYTVSPLTEGSLYVFRVAAENAIGQSDYCEIEDSVLAK
DTFTTPGPPYALTVVEVTKGHVDLKWEPPKNDGGRPIQRYVIEKKEKLATRWVKAGKTAG
PDCNFRVTDVIEGIDVQFQVRAENEAGCGHPSEPTDLIHIEDPTSPPSPPQDLHVTDAGR
NHICIAWKPPEKNGGSPIIGYNVELCEAGTEKWMRINSRPIKDLKCKVEEGVVPDKEYVL
RVRAVNAVGASEPSDISEKVVTKDPDCNPTIDLKTHDIVVVKGQKLSIPVPFRAVPSPTI
TWHKDGKELKAGDRTTMKSDYTSALLEVIESVHADAGVYTITLENKLASTTGSVNVKVIG
PPGQCKDIKASEVTKNSCKVTWEPPDFDGGTPILHYVLERREAGRRTYIPVMSGENKLSW
QVKDLIPNSEYYFRVKAVNKIGGGEYLELRNPIIAEDPKQPPDPPVDLEVHNPTSKSVTL
TWKPPLFDGGSKIMGYIIEKLAKGKERWERCNEYLVPLLTYPVKGLEEGKEYQFRVRAEN
AAGISEPSRITPFVKAVDPIEAPKVFLAANLQSGLEVKKGDEIILEAHISGSPYPSITWL
RNDEVIRPEEIKKRVTTYTRKKKGVTEEEEPFQLSLPERTSIDNHKEGESVLSIRDSIRA
DHGTFTIKVENDHGVAKASCEVNVLDTPGPPVNFVFEDMRKNSVICKWEPPLDDGGSEIL
NYVLEKKDNTKAEMGWVTVSSTLRHCKFHVTKLIEEKEYLFRVFAENRVGAGPPCVSKPM
TAKDPFSPPDPPNKPDVEDVTSNSMLVKWNEPKDNGSPIIGYWIEKREINSTHWARVNRN
LVNALELKVEGLLEGLTYIFRVCAENAAGPGKFSPPSDPKTAQDPIMPPGPPIPRVADTT
SVSIELEWEPPMYNGGGDITGYHVYKQLMGTKEWSRCTEKPIKIRQYTVKEVREGADYKL
RVTALNAAGEGPPGETEPVTVAEPQEPPTVELDVSVKAGIQIMAGQTIKIPATVTGRPAP
TIVWTVEEGELDKDRVVIENVGTKSELTIKNALRKDHGRYVITATNSSGSKSAGTRVEVF
DVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSDIIGFIVERKDAKMHTWRLAIDTERSKC
DITGLVEGQEYKFRVSAKNKFGTGPAVEIGPILAVDPLGPPTAPERFMYTERTKSTITLD
WKPPRSDGGSPILGYIVEKRRHDSKDYERVNPRLCPTTSLLVEKLDELHMYEFRVKAVNE
IGESEPSLPLNVVIQDDEVPPTVTLRLAVRGDTIKVKAGEPVNIPADVTGLPMPKIEWDK
NEVLIDQTSSALKITKEEVSRSEAKTELTLPAAMRDDKGTYTVRASNRLGTAFRNVHVEV
YDRPSPPRNLAVSDIKAESCYLTWDAPLDNGGSEITHYIIEKRDASRKKSEWEEVSNSAV
DRRYGVWNLATNEKYQFRVRAVNKYGISDECLSEKVVIKDPYGLPGPPGKPKILDHTRSS
MLVAWEPPLDNGGSPITGYWLEKREVGGVYWSRVNRAPVTKPSVKGLQYNVLRLAEGVEY
QFRVMAENLAGIGPPSEPSDPALAADPIFVPGPPSCPEIKDKTKSSVSLAWKPPQKDGGS
PIKGYIVEMQDEGSTDWKKVNEGDKLFPTCECVIPNLKELRKYRFRVKAVNAAGESEPSP
ATSDIPIQDILEEPEIFLDIKAQDFLSCRAGTTIKIPAVIKGRPVPKSFWEFEGKAKTTA
KEGGHNVPEEAQVEATDTRSVIIIPECNRSHSGRYSITAKNKAGQKTAHIRVNVLDVPGP
PKDLKVSDITRGSCKLSWKIPDDDGGDRIRGYVIEKRTIDGKAWTKVNANCGSTSFVVPD
LISGQEYFFRVRAENRFGVGPPAETIQRTTARDPIHPPDPPIKLKIGLVTKNTVSLTWKP
PKNDGGAPVTHYNVECLRWDRTGEVKETWKQCNRRDVEETKFTVEDLIEGGEYEFRVKAV
NIAGPSRPSATVGPLVVKDQTCPPSIELKEFMEVEEGTDVNIVAKIKGIPFPALTWEKAS
PKKPDDKKPVSYDQHVNKIVGEDSCTLLIQQSRRSDTGLYTITAVNNLGTASKEMRLNVL
GRPGPPVGPIKFESILADKMTISWLPPLDDGGSKITNYVIEKKEANRRTWVPVTNEPKEC
LFTIPKLMEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFTPPTLDLDFRDKLIVRVGEA
FSLTGRYSGKPTPKITWLRDDIVLKEDNRTKIKTTPTTLCLGILKSVREDSGKYCVTVEN
STGSRKGFCQVTVVDRPSPPVGPVIFDEVHKDHMIVSWKPPLDDGGSEITNYIIEKKDAH
RDIWMPVTSATVKTTCKIPKLLEGREYQIRIYAENLYGISDPLISDEMKAKDRFSVPDAP
EQPVIKDVTKDSAVVVWNKPYDGGKPITNYIVEKKETMATRWVRVTKDPIFPSTQFKVPD
LLEGCQYEFRVSAENEIGVGNPSPPSKPIFARDPIVKPSPPVNPEAVDKTKNSVDLTWQP
PRHDGNGKIIGYLVEYQKVGDEEWKKANLTPDSCPETKYKVTGLTEGLTYKFRVMAVNAA
GESEPAYVPDPVEVKDRLEPPELILDANMAREQHVRAGDTLRLSAVIKGVPFPKVSWKKE
DKEVSPKADIEVTGVGSKLEIRNTAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRN
LQVSDVRSDSCYLTWKEPEDDGGSVITNYVVERKDVASPQWVSVSSTSKKRSHMAKYLME
GTQYLFRVAAENMFGRGPYVETLKPIKAVDPLHPPGPPKNLHHVDVDKTEVSLVWNRPDR
DGGAEITGYLVEYQEDGADEWTKFQTVPMLDCVVTGLQKGKIYKFRVKAQNIVGLSLPDT
TIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRLPAIMRGVPVPTAKWVTDDTEIKTEG
RHKIETDNYSTVLTIKDCVRKDTGEYLLTVSNAAGHKTVALHLTVLDVPGPPTGPINILE
ITPEHMVISWRPPKDDGGSPIINYIVEKRQSKKETWGVVSSGTSHTKIKIPRLQKGCEYI
FRVRAENKIGIGAPLDSEPTVAKHMFDPPSPPGKPVVFDITENAATVSWTLPMSDGGTPI
TGYILERREASGKWVRVNKAPILDMKYRVTGLFEGNTYEFRVFAENMVGLSKPSPSSDPI
KASRPITPPGPPINPKLKDKTKETADLVWTKPLKDGGSPILGYIVECQKTGTTQWNRINK
DDLIRQCAFRVPGLIEGNEYKFRIKAVNIVGEGEPRELAETVLAKDILSPPEVSLDVTCR
DLITVRVGQTIHITGKVKGRPDPDITWSKDGKVLVQEKRIEIVHDLPNVGLQVKEAKRSD
HGKYIIAAKNSCGHAQGFAIVNVLDRPGPCQNLKISYVTKDSCMIAWESPVDNGGSEITN
YIVEYRQPNQRGWSIVSSDVTKRLVKANLIENREYFFRVCAENKIGPGPCIETKTPILAI
NPIDKPGEPENLHIAEKGKTFVFLKWRRPDYDGGSPNLSYHVERKLKDSDEWERVHKGSI
KETHYMVDKCVENKIYQFRVQTKNEAGESDWVKTAEVVVKEDLQKPVLDLKLSGVLTVKA
GDTIRIEAGVRGKPQPEVAWTKDKDATDLTRSPRVSIETTSDTSKFVLTKSRRSDGGKYV
ITATNTAGSFVAYATVIVLDKPGPVRNLKVTDISSDRCTVTWEPPEDDGGCEIQNYILEK
CESKRMVWSTYSSSVLTNYANVTRLIEGNEYIFRVRAENKMGIGPPTETHPIIAKTKFDR
PGRPDPPEVTRVSKEEMTVVWNPPEYDGGKSITGYILEKKEKRSLRWVPVTKTAIPERRK
KVTNLIPGHEYQFRVSAENEVGLGEPSLPSRPVVAKDPIEPPGPPTNLRVVDSTKSSITL
GWGKPVYDGGAPIIGYVVEIRPKVEGADPEAGWKRCNVAAQVIHTEFTATSLDEKQLYEF
RVSAQNQVGLGRPAELKEAVSPKEILEPPEIELDASMRKLVTVRAGCPIRLFAIIRGRPA
PKVTWRRMGIDNVIRKGQVDLVDTMAFCVIPDSTRDDSGKYSLTLVNVAGEKAVFVNVRV
LDTPGPVSDFRVSDVTKMSCHLSWAPPENDGGSPVTHYILQKREADRKTWGTVTAELKKT
SFQIANLVPGNEYYFRVTAVNEYGSGVPSDIPKPVLATDPLSEPDPPRKLEVTEITKNSA
TLGWLPPLRDGGSKVDGYIVSYKEDDQPGDRWTEYSVVKDLSIVVAGLKEGKKYKFRVAA
RNAVGVSFPREAEGVFEIKEQLIPPKILMPDHVHIKAGKKLRIEAHVYGKPQPVCKWLKG
DQDVITSSRLAVHKAEKSSVLIIKDVTRKDSGFYTLTAENSSGTDSQKIRVIVMDKPGPP
QPPFDISEIDADACTLAWHIPLEDGGSNITNYVVEKCDVSRGDWVTALASVTKTSCRIGK
LIPGEEYMFRVRAENRFGISEPLNSDKMIARFPFDVPSEPKNARITKVNKDCIFVAWDRP
DSDGGSPITGYLIERKERNSLLWVKANDTAVRSTEYPCVGLIEGLEYTFRIYALNRAGAS
KPSKPTEMVTARTPVDPPGKPEVIDVTKSTASLVWTRPKHDGGSKLIGYFVEACKLPGDK
WVRCNTTPHQIPLEEYTATDLEENAQYQFRAIAKTAVNISQPSEPSDPVTIHPENVPPRI
ELDLSMQSQLTVKAGTNVRLEAKVYGKPMPTITWKKEGEHLKPSEGVKITTKRNLAVVEL
FSVNRKQTGDYTITAENASGSKSATIRLKVLDKPGPPASVKIKHMYADHAMLSWEPPLED
GGSEITNYIVDKRETSRPNWAQVSATVPITSCTVEKLIEGHEYQFRICAENKYGVGDPIL
TEPAVAKNPYDVPGPCDPPVISNVTKDFMTVSWKPPANDGGSPITGYILEKRETKALNWT
KVNRKPVIERTVKASGLQEGTEYEFRVIALNKAGPGKPSAPSKAVYARDPQYPPGPPAFP
KVVDTTRNSISLSWSKPAYDGGSPIIGYLVESKRADTDNWVRCNLPKNLQATHFVVTGLM
EDTEYQFRIYAVNKIGYSDPSDVPDKHTAKDILIPPEGELDAELRKVLVLRAGVTMRLYV
PVRGRPPPKITWSKVGANLRDRQGLDIKSTDFDTFLRCENVNKYDAGKYVLSLENSCGKK
AYTIVVKVLDTPGPPVNLVVKEASKDSAYITWEPPLIDGGSPITNYVVEKRDAERKSWST
VTAECPKTSYRITNLEEGKSYFFRVFAENEYGIGDPCETRDAVKASETPGPVVDLKASAV
TKSSCNLVWKKPISDGGSRIFAYVVEVLIGEDKWQEVMRSKNLHYSMKDLKEGQEYTFRV
RAQNDAGYGTPRELTIVARDDVVAPDLDLRDLPDLCYVAKEGSNFRLKIPIKGKPFPTVT
WKKDEDKALTESGRVAFESTAVNTTLVVHDCQKADAGKYTITLKNVVGSKEGTISVKVVG
KPGIPTGPVKFDEVTADAMTLKWGPPKDNGGSEITNYVLEKRDNISNKWVTCASAVQKTT
FRVTRLHEGNEYTFRIRAENKYGVGEGLKSDPVVAKHPFDVPDAPPPPNIVDVRHDSVSL
TWTDPRRTGGSPITGYHIEFKERNSLLWKRANTIPIRMKDFRVTGLTEGLEYEFRVMAIN
IAGVGKPSPPSEPVVALDPIDPPGKPEVINVTRNSVTLIWTEPKYDGGHKLTGYIVEKRD
LPSKTWTKANHVNVPDCAFTVTDLTEGSKYEFRIRAKNTAGAISPPSESTGTIICKDEYE
APTIVIEPTLKEGLTVKAGDTITVSAISIRGKPPPTSAWSKAGKDFRPSELVHIETTPTS
STLTIKYAARKDSGEYTITATNPFGTKQESVHVKVLDVPGPPGPIEISNVSAEKATLTWS
PPAEDGGSPIKSYILEKRETSRLLWTLVAENIESCRHVVSKLIQGNEYVFRVSAVNQYGK
GEPVQSEPVKMVDRFGPPGPPGKPEVTNVTKNTVTVTWKRPVDDGGSEITGYYVERREKK
GLRWVRATKKPVSDLRCKVTGLLEGSEYEFRVSAENRAGVGPPSDASNSVMCKDVAYPPG
PPANPRVTDTTKTSASLAWGKPHYDGGLDIIGYIVEHQKEGEEEWVKDTTGTALRITQFV
VAHLQPGAKYNFRISAMNAVGTGEPALIPSVEIKEREEIPDFELDAELRRTLVVRAGLTI
RIFVPIKGRPTPEITWTKDDVSLKGRASIENTDSFTLLIVTECTRYDAGKYVMTLENAAG
KKTGFVNVKVLDTPGPPINLKPREITKDSITLQWDMPLIDGGSRITNYIVEKRESTRKAY
STVTTNCQKCSFRIPNLSEGCEYYFRVLAENEFGIGEPAETAEPVRASEAPSPPDSLNIM
DVTRNSVSLAWPKPEHDGGSKITGYVIEAQRKGTNQWTHITTVKTLDCVVKNLTENEEYT
FQVMAVNSAGRSAPRESRPIIIKEQTMLPEFDLRSIYQKTVIAKAGDNIKIEIPVLGRPR
PTVTWKKEDQILKQTQRVNYENTATATILTINECTRGDSGRYPLSAKNIVGEVSEVITVQ
VHDIPGPPTGPIKFDEISSDFVTFSWQPPLNDGGVPISNYVVEMRQTDSTTWTELATTVI
RTTFKASRLNTGVEYQFRVKAQNRYGTGPAITSESVVANYPFKVPGPPGTPQVIAVTKET
MTISWNEPITDGGSPILGYHIERKERNSILWQTVSKMLVSGNIFKSTGLSDGIAYEFRVI
AENLAGKSRPSKPSEPVFALDPIDPPGKPVPLNITRHAVTLKWTKPEYNGGFKITGYTVE
KRDLPNGRWLKANFSNILETEFTVSGLTEDAAYEFRVIARNAGGAVSQPSEPSDAVTCRD
DIEAPRISVDAKYKDTLVLKAGEVFRLEADVSGRPPPAMVWTKGEKELEDTAKLEIKTAD
FSTVLINKDSSRRDGGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSEVTAEKCVL
SWLPPLDDGGAKIEHYVVEKRETSRLAWTAVATEVPLTKLKVTKLLKGNEYVFRVMAVNK
YGVGEPLESEPVLAVNPYVPPDPPKTPEVTAITKDSMVVCWGHPDSDGGSPITNYIVERR
DRAGLRWVKCNKRVVTDLRYKVSGLTEGHEYEYRVMAENAAGVSEPSPTSPFYKACDTVF
KPGPPGNPRVLDSSKSSITIAWNKPIYDGGSEITGYMVEIALPEEDEWKIVTPPVGLKAT
SFTITDLKENQEYKIRIYAMNSEGLGEPALVPGTPKAEERLLPPEIELDAELRKVVTIRA
CCTLRLFVPIKGRPAPEVKWTREHGESLDRATIESTSSYTLLIVENVNRFDSGKYMLTIE
NSSGSKSAFVNVRVLDTPGAPQNLKIKEVTKSSVTLTWEPPLIDGGSKIKNYIVEKREST
RKAYSTVNANCHKTSWKVDSLQEGCNYYFRVLAENEYGIGLPVETSESVKVSERPLPPGK
ITLLDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWSTCATVKVTEATITGLIQG
EEYTFRVSAQNEKGVSDPRQLGIPVVAKDLVIPPAFKLLFTTFSVLAGEDLKVDVPFVGR
PKPAVLWHKDNVALKQTTRVNAESSENNTVLTIKEACREDVGAYLVKLTNSAGEATEILN
IVVLDKPGPPTGPVKVDEVTADSITISWEPPKYDGGSSINNYIVEKRDTSTTIWQIVSAT
VARTTIKACRLKTGCEYQFRITAENRYGKSTYLTSEPVVAQYPFKVPGPPGTPFVTNASK
DSMVVQWNEPVNDGGSKIIGYHLERKERNSILWAKLNRTPIPDTKFKTTGLEEGLEYEFR
VYAENIVGIGKASKASECYTAHDPCDAPGRPEPLIVTRSSVTLQWKKPIYDGGSKITGYV
VEKKELPDGRWMKASFTNVIDTQFEVTGLVENQRYEFRVIARNAAGVFSEPSESSGAITA
RDEVEPPHISMDPKYKDTIVVHAGESFKLEADVHGKPIPSIQWLKGDHELTNTARMEIKS
TDFATSLSVKEAIRVDSGQYVLLAKNVAGEKKVPVHVKVLDRPGPPEGPVEITGVTAEKC
MLSWKPPLQDGGSDISHYVVEKRETSRLVWTVVDSNVQTLSCKVTKLLEGNEYIFRIMAV
NKYGVGEPLESEPVLAKNPFVVPLPPKAPEVTAITKDSMIVVWERPASDGGSEILGYVLE
KRDKEGIRWTRCNKRLISELRYRVTGLIENHNYEYRVSAENAAGLSEPSLPSTYYKACDP
IYKPGPPNNPKVVDVTRSSVFLSWSKPIYDGGSEIQGYIVEKCDVSDGEWAICTPPTGIK
NTHMEVEKLVEKHEYKFRVCAVNKAGVGDHADVPGSVIVEEKMEAPDLDLDMELRKIVNV
RAGGSLRLFVPIRGRPAPEVKWGKVDGEIREAAIIDTTSSFTSLVLDSVNRFDTGKYTLT
LENSSGTKSAFVSVRVLDTPSAPINLKIREITKDSVSLSWEPPLLDGGAKIKNYIIEKRE
ATRKAYAAVVTNCHKTSWKVDQLQEGCYYFFRISAENEYGIGLPAETSDPIKVAEVPQPP
GKITVDDVTRNSVSLSWAKPEHDGGSKIIQYIVEMQAKGSEKWSECARVKTLEAVITNLT
QGEEYLFRVMAVNEKGKSDPRALAVPVVAKDLVIEPDVRPAFHSYSIQVGQDLKVEVPVS
GRPKPTVTWVKDGQTLRQTTRVNVSDLTDLTVLNIKETSKEDTGTYEITVANVVGQKSAS
IEIITLDKPDPPLGPVKFDEVSAESVTLSWNPPAYTGGCQITNYVVHKRDTTTTVWETVS
ATVARTVLKVTKLKTGSEYQFRIFAENRYGQSFALESAPVVAQYPYKEPGPPGTPFVTIV
TKDSMVVQWHEPINDGGSKVLGYHLERKEKNSILWTKVNKTIIQDTSFKTTNLEEGIEYE
FRVSAENIVGIGKTSKVSECYVARDPCDPPGRPEAIIIKRSSITLQWTKPEYDGGSKITG
YIVEKRDLPDGRWMKASFTNIIETQFTVTGLTEDQRYEFRVIAKNAAGAVSKPSDSTGPI
TARDEVELPRISMDPKYKDTIVVNAGDTFRLEADVHGKPLPTIKWYKGDKELEETARYEI
KNTDFNALIIVKDAIRIDGGQFILEASNVAGTKTVPVNVKVLDRPGPPEGPVQVTGVTAE
KCSLSWSPPLHDGGSDISHYIVEKRETSRLAWTVVASEVVPTMLKVTKLLEGNEYIFRIM
AVNKYGVGEPLESVPVMMKNPFVVPSPPKALEITNITKDSMTVCWSRPDSDGGSEIIGYI
VEKRDRAGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGLGEPSQVSPYFKAC
DPIFKPGPPTNAHVVDTTKSSVTLGWSKPIYDGGCEIQGYLVEICKADEDEWSLVTPQTG
IRATRFEIKKLTEHQEYKLRVCALNKVGVGEAASVPGTVKPEDKLEAPELDIDSELRKGI
VVRAGGSARIHIPFRGRPIPDITWSREEGEFTEKVQIDKGINYTQLSIDNCDRNDAGKYI
LKLENSSGSKSAFVTVKVLDTPGPPQNLIVKDIKKDSAVLSWEPPIIDGGAKVKNYVIDK
RESTRKAFANVSAKCGKTSFKVENLTEGAIYYFRVMAENEFGIGVPAETADAVKASEPPL
PPGKVTLTDVTQRSASLTWEKPEHDGGSRILGYIVEMLPKGTEKWSVVSETKTCSAVVSG
LSSGQEYQFRVIAYNEKGKSDPRALGVPVIAKDLTIEPSFKLMFNTYSVQAGEDLKVEVP
FIGRPKPTITWTKDEQPLKQTTRLNIENTSTSTILHIKESNKEDFGKYTVTASNTAGTAS
EQLSIIVLEKPGPPRGPVRFDEVSADFVVLSWDPPDYTGGCQISNYIVEKRDTSTTTWNI
VSATVARTTIKATKLKTGSEYQFRISAENRYGKSSPLDSKPVVVQYPYKVPGPPGTPFVT
AASKDHMIVQWNEPVNDGGSKVLGYHLERKDKNSILWIKQNKSLIADTTYKTDGLEEGLE
YEFRVSAENIVGIGKVSKVSELYVARDPCDPPGRPEAIVVTRNNITLRWKKPEYDGGSKI
TGYIVEKKELPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGCLSEPSESTG
PITARDEIEAPGASLDPKYRDVIVVHAGETFILEADIHGKPIPDITWSKDGKDLEEATAR
MEIKSTIQKTTLTVKDCVRVDGGHYTLNLRNVGGTKSIPITVKVLDRPGPPEGPLKVTGV
TAEKCYLAWAPPLHDGGSSISHYIIEKRETSRLSWTQVATDVQALNHKVTRLLAGNEYIF
RVMAVNKYGTGEPLESEPVVARNPYKPPGPPSTPEVSAITKDSMVVTWGRPEDNGGAEIE
GYILEKRDKDGVRWTKCNKKRLTDLRFRVTGLTDGHFYEFRVSAENAAGVGEPSEPSIFY
RACDVLYPPGPPSNPKVTDTSRSSVSLAWGKPIYDGGAPVKGYVVEAKEAAADEWTTCTP
PTGLQAKQFTVTKLKENQEYNFRICAINSEGVGEPAVIPGTVLAADKIEPPEIELDADLR
KVVIVRASGTLRLFVTIKGRPEPEVKWEKAEGTISDRAQIEVTSSYTMLVIDNVNRFDSG
RYNLTLENNSGKKSAFVNVRVLDTPSAPVNLTVREVKKDFVTLAWEPPLIDGGAKITNYV
VEKRESTRKAYATITNNCTKNSFKITQLQEGCSYYFRVLAVNEYGAGLPAETPEPIKASE
PPSPPAKVILVDVTRNSASIKWEKPESDGGSKITGYIVEMQTKGSVKWSACTQVKTLEAT
ITGLSMGEEYSFRVIATNEKGKSDPRELGVPVIAKDIEIQPSAELLFNTFTVKAGDDLKI
DVPFRGRPLPSISWKKDGNPLKETTRVNVQTSKTSTSLSIKEASHEDVGHYELHLSNSAG
STTASLTVVVLDRPGPPTDVHIEEVSADSVTLSWKPPEYDGGCHISNYIVEKRDTTTTTW
DIVSAAVARTSIKVSRLTTGSEYQFRICAENRYGKSIHVNSPSVVAEYPFKPPGPPGTPH
VAHATKAFMIVTWQVPVNDGGSRVLGYHLERKERSSILWAKVNKSLIPDTQMKVTGLDEG
LMYEYRVYAENIAGIGKCSKSCEPVAARDPCDPPGQPEVTNITRTCVSLKWTKPEYDGGA
KVTGYIIERREMPDGRWLKCNFTNVQETYFDVGGLTEDQRYEFRVIAKNAAGLFSQPSES
TGPVTVKDDVEAPRIMMDVKFRDVVVKAGEVFKVNADIAGRPIPVVSWTKDGKELEGKAR
VEIASTDHATAITVKDCIRGDSGQYVLTLQNVAGTRSLAINCKVLDRPGPPAGPLEITGL
TAEKCHLSWGPPQENGGADIDYYVVEKRETSRIAWTICEGELKTTSCKVTKLLKDNEYIF
RVMGVNKYGVGEPLESVAVKALDPFTVPSPPTSLEITSVSKDSITLCWARPESDGGNEIS
GYVIERREKTSLRWIRVNKKPVYDLRVKSSGLREGCEYEFRVYAENAAGLSLPSQSTPLI
RAEDPIFLPSPPSKPKIMDSTRSNITIGWTKPLFDGGAPVTAYTVEYKKTDETEWTTAIQ
NLRGTEYTISGLVSGSEYVFRVRSINKMGVSEPSDSSEPHLAKEREEEPAFDIDSEMRKT
LIVKAGESFTMTVPFRGKPVPNVTWNKPDTDLRTRASIDVSDNCTSLTIEKATRNDSGKY
TLTLQNVVNTATLTLVVKVLDTPGPPSHVTTKDVTKESAVLSWDVPDNDGGAPVKNYVIE
KREASKKAWVTVTNNCHRLSYKVTGLQEGAIYYFRVSGENEYGVGVPSETKEGTKITEKP
SPPEKLGVTNVTKDSVSLSWLKPEHDGGSRIVSYLIEALEKGQQKWVKCAVVKTTHHVVH
GLKENVDYFFRVSAENQAGLSDPKELLLPVTVKEQLESPEIDMKGFPHNTVYIRAGSNLK
VEIPVSGKPLPKVTLSRDGAPIKPTLRFHTEMTAESFIVNLKESVAADAGRYDITAANSS
GTTKSFINIVVLDRPGPPVGPVVLSDITEESVTLRWQPPAYDGGSQVTNYIVLKRETSTA
AWSEVSATVARTVIKVMKLTTGEEYQFRIKAENRFGISDHVDSQCVVVKLPYTTPGPPST
PWVTSVTRESITVGWHEPVTNGGSAVVGYHLEMKDRNSILWQKANKILIRTTHFKVTTIS
AGLIYEFRVYAENAAGIGKASHPSDPVLAIDACEPPRNVRVSDISKTAITLSWQKPAFDG
GSKITGYIVEKRDLPDGRWSKASFTNVIETQFTVSGLTQNSRYEFRVFAKNAIGSISNPS
DVVGPITCVDTYGAPEIDVPPEYTEVVKYKAGTSIKLKLGISGKPTPTIEWFKNGSELQT
SSLLSIENTTEFASILIKDATRLNSGTYELKLKNAMGSASAHVRVQILDKPGPPTGPIQF
KTVTAEKITIMWDPPADDGGAPVTHYVVEKRETSRVVWSLVSEKQEGCIITTTKLVKGNE
YVFRVRGVNKFGVGDSLESEPVIAKNSFVAPGPPGVPEVTMITKNSMTVVWSRPTVDGGS
EISGYFLEKRDKKSLSWFKVTKETIRDTRQKVTGLTENSEYHFRVCAVNAAGQGPFCEAS
DFYKAVDPVDKPGSPTKLKVVDTTKTSVTLGWIKPTYDGGSPITSYVVEKREGEEQEWTV
VSSKGEVRTTEYVVSHLQPSINYYFRVSAINCAGQGEPIEMTEPVQAKDILVAPEIDLDV
ALRTSIIAKAGEDVEIMIPFKGRPPPTVTWRKGEKNLGTDEKYIIQNTESSTLLSIPQVT
RDDTGKYVLTIENGVGEPKSSFVNVKVLDTPSACQKLQLKHVSRGTVTLVWEPPLINGGS
EITNYVVEKRDATKRAWSTVTTKCSQTTFKLTNLSEKTAFFFRVLAENEIGLGEPCETSE
PVKAADIPGPIKDLAMKDSTKTSVKLHWSKPDYDGGSIISDYIIEKKLQGEKEWTYAGTS
KSCEFEVEKLKELSVMEFRVFAKNEKGMSDGVTVGPITVKEYIITPEADLSDIPGGQVTV
RIGHNLHIELPYKGKPKPSMSWLKDNLPLKETEQLRFKKTENKISLSIKNVKKEHGGKYT
LILDNVVSRKTFTITVITLGPPSKPKGPLRLDEVKADSVVLSWEAPEDDGGGEITGYSIE
KRETSQMNWKLVCSSAARTTFKVPNLVKDTEYQFRVRAENRYGVSPPLVSVDVVAKHQFR
TPGAPGKPVVYNVTADGMTIAWDAPAYDGGSEIIGYHVEKKERNSILWQKVNVALISSRE
YRITGLVEGLDYQFQVYAENAAGLSRASEPSKFTLAVSPVDPPGTPDYIDVTRETVTLKW
TPPLRDGGSKIVAYSIEKRQGSEDRWLRCNFTDVSECQYTVTGLSPGDRYEFRVLARNAV
GTISPPSQSSGYIMTRDENVAPTIEFGPEHFEGLTVKAGESIRLKALIKGRPVPKVTWFK
DGKEIEKTMSIEITTDIGYSTIFIRDATRDHRGVYTVEAKNASGTKREDITFRIQDTPGK
VGGPIRFTNITGEKVTLWWEPPANDGCACISHYIIEKRETSRIAWALVDDKCEACSYTAL
KLIKGNEYQFRVSAVNKFGAGRPLESDPVVAQIPYTLPDAPGTPEPTNVTGDSITLTWAR
PKSDGGSEINEYILERREKKSMRWVKVTSKRPIAENRYRVTGLIEGNEYEFHVMAENAAG
IGPPSDVSKLIKCREPVSPPSAPNVVRVTDTSKTSVSLEWTKPVFDGGMEIIGYIIEMCK
ADLETWQKVNAETVLATKYTVVDLEAGEHYKFRVSAVNGAGKGESCEVPASVQTVDRLSA
PEIDIDANFKQTHIVRAGATIRLFIAFSGRPVPTAVWSKADANLSLRADIQTTDSFSTLT
VEECNRNDAGKYVFTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSITLMWDAPVL
DGGSRIHHYVVEKREASRRSWQVVSSKCTRQIFKVTDLAEGVPYYYRVSAENEYGVGEPC
ELTEPIVATEEPAPPKRLDIVDTTKSSVVLAWLKPDHDGGSRVTGYLLEMKQKGSDKWIP
AGQTKQLTFTVEGLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLSEISR
QLITCKAGSTFTIDIPISGRPAPKVTWKLEEMRLKETERVAIKTTKDRTTLTVKDSMRGD
SGKYYLTLENTAGVKTFTVTVVVIGRPGPVTGPIEISSVSAESCILTWKEPEDDGGSDIT
NYIVEKRESGTTAWQLVNSSVKRTQIKVTRLTKYQEYSFRVSSENRFGVSKPLESKTIVA
EHPFVPPSPPTRPEVYSVSANAMAIRWEEPYHDGGSKVIGYWVEKKERNTILWVKENKVP
CCECNFKITGLVEGLEYQFRTYALNAAGVSKASEASRPVVAQNPVDPPGRPEVTDVTRST
VSLSWSPPLYDGGSKVIGYIIERKPYNESGDGRWLKCNYTIVSENFFTVTALGEDEAYEF
RVLAKNAAGVISKGSESTGAVICKDEYSPPKAELDARLQGEVVTIRAGSDLVLDAAIGGK
PEPKVFWSKGDKELDLCEKISLQYTSKRAIAIIKFCDRSDSGKYTLTVKNASGTKQISVL
VKVLDSPGPCAGKITVSRITEEKCTLAWNIPEEDGGAQITHYIVERRETSRLHWVIVEAE
CQTLSCVVTKLIKNNEYIFRVRGVNKYGPGVPLETEPVIARNAFTIPTQPGTPEEVSVGK
EHIIIQWTKPESDGGSEIKDYLVDKRERKSLRWTRVNRDYTIYDTRLKVTGLMEGGQYQF
RVTAVNAAGNSEPSEASQYMLCKEPSYTPAAPSAPRVVDTTMHSISLAWSKPTYDGGADI
LGYVLEMKEEGTEQWYRPHTTPTLRNAEFTITGLKTSQKYRFRVAATNVNGMSEFSESSA
EIEPVERIEKPELELADDLRKTVTVRAGGSLRLMVSVSGRPAPVITWSKEGIDLVSRGII
DTTDSYTLLIVDKVNRYDAGKYVIEAENQSGKKSATISVKVYDTPGPPAAVRIKEVSRDS
ATLTWDIPTIDGGAPVSNYIIEKREASMRAYKTVTTKCSKTFYRVTGLLEGALYYFRVLP
ENIYGIGEACETSDAVLVSDVPIPPQKLEVIDTTKSTVTLAWEKPAHDGGSRLTGYVIEA
SKAGTERWLKVVTVKPTVYEHTIISLNEGEQYLFRVRAQNQKGVSEAREIVTAVTVQDQK
VLPTIDLAGIPQKTIHVPAGKPIELAIPIGGRPPPAASWFVAGSKLKESERIKMETVAKM
AKLTVRETTIHDTGEYTLELKNTTGTVSDTIKVIILDKPGPPVGPIRIDEIDSNYVIISW
EPPELDGGATLSGYVVEQRDAHRPGWLPVSESVTRTTYKFTRLVEGAEYVFRVAATNRFG
IGSYLQSEIIECKSRIRIPGPPGTPEVFDVSRDGMTLTWHPPDDDGDSRITGYIVERKEI
RADRWIRANKVPVTMTRYRSTGLVEGLEYEHRITAINARGAGKPSRPSKSVVARDPIAPP
GKPQNPRVTDTTRTSVSLAWSPPEDEGGSKVTGYLIEMQKVDQYEWTKCNTTPTKIREYT
LTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKITEMLEYPDFELDEKYQEGLMVRQGGV
IRLTIPIKGKPIPVCKWTKEGHDISKRAMIATSDTHTELVIKDAEREDSGTYDLALENKC
GKKAVYIKVRVIGIPNPPEGPLEYDDIQARSVRVSWRPPTDDGGADILGYIVERREVPKT
AWYTVDSRVKGTSLVVKGLKENVEYHFRVSAENHFGISKSLKSEEPAVPKTPLNPPEPPN
NPPEVLDVTKSSVNLSWSRPKDDGGSRVTGYYIERKETSTEKWVRHNKTQITTTMYTVTG
LVPDAEYQFRVVAQNEIGESEASPASEPVICKDPFDKPSQPGEIEITSISKDSITMEWER
PESDGGKEILGYWVEYRQSGESTWKKCNKELIKDRQFTVGGLLEATEYEFRVFAENQTGL
SRPRRTAMAVKTKLTSGEAPAIRKEMQDVTTKLGEAAQLTCQIVGRPLPDIKWYRFGKEL
VQSRKYKMSSDGRNHTLTVLTDEQEDEGLYTCMATNDVGEIETSGKLLLQAPPQFHPGFP
LKEKYYAGAGGTLRLHVVYIGRPVPAITWFHGNKPLRGSESVTIENTEHYTHLAIKNVQH
KTHAGKYKVQLSNTFGTVDTVLNVEIQDKPDKPEGPIVIESVLKNSVVISWKPPEDDGGA
MITNYIIEKREAKEGAEWELVSSSISGTTCRIVNLTENAGYYFRVSAQNTYGISEALEVS
SVVVMKPPFEKPGQPGQPVASAVTKDSCVVSWKPPASDGGAKIRTYYLEKREKKQNKWIS
VTTDEIRETVFSVKDLIEGLEYEFRVKCENLGGESEWSEVSQPVIPKSDVPIQAPHFKEE
LRNLNVKFQANATFVCKVTGHPKPIVKWYRQGKEIMPDGEKIKIQEFKGGYHQLIITNVT
DDDATVYQVRATNQGGSVSGTASLDVEVPAKIHLPKNLEGMGAVHALRGEVVSIKIPFSG
KPPPVITWQKGQDLIDTNGHYQVIVTRSFTSLVFPNGVDRKDAGFYIVCAKNRFGIDQKT
VELDVADVPDPPRGLKVTDISRDSVNLTWIEPATDGGSRIINYIIEKRATTAERWIRVAQ
ARDTRYTVVNLFGKTTYQFRVIAENKFGQSQPSEPTDPIITKEDKTRIMNYDEEVDETRE
VTTAKAAHYSTKELYDKYMIAEELGRGQFGIAHRCVEAVSKKTYLAKFVKVKGADQVLVK
KEISILNIARHRNILHLHESFESLEELVMIFEFISGVDIFERISTASFELNEREIVSYVR
QVCDALEFLHRHSIGHFDIKPDNIIYFTRRSSVVKIVEFGQARQLKPGDSFRLQFTSPEY
YAPEVHHHDLVSTATDMWSVGALTYILLSGINPFIAETNQQVIENILNAEYNFDDEAFKD
ISIEAMDFIDRLLVKERKARMTAAEALNHTWLKQKTEKTSTKTIKTLRHRRYYHTLVKKE
WNTVVSVARISCGGAIRSQKGVTVAKVKVAPIDIGPIAGQINHAAAEEGGHAKYVCKIEN
YDQSTQVTWYFGMRQLENNEKYEINYEEGVATMYVKDVSKSDDGTYRCKVINDYGEDSSY
AELFVKGVREMSEHYRCRAVRKVKRRVDAMRLLERPPEFTLPLYNRTAYVGENVRFGVTI
TVHPEPRLTWFKSGQRIKPGDDDKYTFESDKGLYQLIINKVTEEDDAEYSIVARNKYGED
SCKAKLTVIPHPPPADTTLRPMFKRLLANAECQEGQNVSFEIRVSGIPKPTLTWEKDGQP
LSFGPNFDIIHEGLDYYALHIRDTLPEDSGYYRVTATNSAGSTSCQAYLKVERLKYVKRE
YKTEEEREKHVQRQIDKTLRMAEILSGTEAVPLTQTAQEALREAAILYKPAVSTKTVKGE
YEIKKEEKKEERKLRMPYEVPEPRKHVRTTLEEDQTIKHFVPLSDMKWYKRLRDQYEMPG
KLERTVQKRQKRIRLSRWEQFYVMPLPRISDQYKPKWRIPKLTQDDLETVRPARRRAPSP
DYEFYYRPRRRSLGDLSDEELLLPIEDYLAMKRTEEERLRLEEELELGFSASPPSRSPPR
FELSALRYSTAGAQVQSEEERKRELRYSSYHIPAKADTSASYAELRQRYDRAAYRPPKQK
QRIMAEREDEELLRPVGATQRLSEYKSELEYMAEEEKSRLRRRREREITEITSEEEEEIE
MVQHVHREFSPPSRLLRRRRSLSPTYIELMRPVSELIRPRSRPPEESERRSPTPERTRPR
SPSPVSTERSLSRFERMARFDIFSRYESMKSALKTQKTMERKYEVLTQQPFTLDHAPRIT
LRMRSHRVPCGHNTRFILNVQSKPTADVKWYHNGIELQESSKIHFSNTSGVLTLEILDCH
IDDSGTYRAVCTNYKGECSDYATLDVTGGDYTTYSSQRRDEEVPRSILPDLTRTEAYAVS
SFKKASATEASSSVREVKSEVSATRESLLSYEHHASSEEKTTASEEKSLEERTVRKAFKS
TLPATILTKPRSITVSEGETARFSCDVDGEPAPTITWVRAGQPIVSSRRFQITRTQYKST
FEISLVQISDEGSYTVVVENSEGRQEAHFTLTVQRKRIPEKAITSPPRIKSPEPRVKSPE
PVKSPKRVKSPEPISTHPKAKSPPGDKTAPVEKVQLPTASPPKIKEQLKAETLGDKVKLS
CAVESSALSVREVAWYKDGKKLKEDHHFKFHYAADGTYELKIHDLTESDKGEYTCEIMGE
GGISKTNFQFTGQVFKNIHSQVRSVSETHKLVEKGDEVLTVSTQKKSSVAAEEKSAVEEV
IKKSIVTEDVKQLKTEIRASSTQMTMSEGQKVTLKANIPGASEVKWVLNGMELRNSDDYR
YGISGSDHTLTIKKASNKDEGILTCEGKTDEGVIKCQYVLTFSKERSNEPAFIMQPKSQN
VNEGQDVLFTCEVSGDPSPEIEWLRNNQPIAVSSHMRVTRSKNTYSLEIRNAAVSDTGKY
TVKAKNYHGQCSATASLTVFPLIEEPPKEVVLKTSGDASMHESFSSQSFQMAASKQEASF
SSFSSSSMTETKFASMSAKSMSSMKESFVEMSSSSIMGKSSMAQLESSTSKMLKSGVRGV
PPKIEALPSDISIDEGKVLTLSCAFSGEPAPEITWYCRGRKITSQDQQGRFHIETSEDLT
TLIIMDVQKNDGGIYTLNLGNEFGTDSATVNINIRSI
NT seq 100734 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaaagcaccaacatttacgcagccgttacaaagtgttgtggcactggagggt
agtgccgcaacctttgaggctcatattagtggtttcccagttcctgaggtgagctggtat
cgggatggccaggttctctctgctgcaactctgcccggagtgcagatctcgtttagtgat
ggccgcgctaaactagtgatcccctccgtgacagaagcaaacagtggaagatataccata
caagccaccaatggatctgggcaagcaactagtactgctgagctacttgttacagctgga
actgcaccaccaaacttttcacaacgactacagagcatgactgcaaggcagggaagtcaa
gttcgacttgacgtgagagtgactggaatccctacacctgtggtgaagttttatcgggat
ggagtcgaaatccaaagctcccccgattttcaaattttacaagaaggagacctttacagc
ctaataattgcagaagcatatcctgaagactccggcacttattcagtaaatgccacaaat
aatgtgggacgtgctacttcaacagctgaactgctgattcaaggcgaagaagaagctgtt
cctgctaaaaagacaaaaacaattgtttcgactgctcagatttcacaaacaagacaagcc
agaattgaaaagaaaattgaagcccactttgatgccagatcacttacaagtgttgaaatg
gtcatagaaggtgcaacagcccaacagctcccacacaaagcacctccacgaatgcctcct
agacctacatcaaaatcaccaactccaccagtaattactgcaaaagctcaaatggcacga
cagcagtcaccatcacctgtaagacaatcaccatcacctgtaagacatgtcagagcacca
acaccctcaccagtaaggtccgtttctcctgctggaagaatttctacctctcctattaga
ccagtgaaatctccatcaccaatccgtaaagcacaggtagtgacacctggggctgaagtc
cttcctccttggaggcaggaaggatattctgcaaccactgaagcccagatgaaggaaacc
agagtatccacaagtgctactgaagtaagaactgaagaaagatgggaaggaagatatggt
ctgcaagaacaagttaccattagtggtgccgctgctggtgaggttgcagctggtgctaaa
gaggtgagaagggacagtgaaaaaacagcagctgttgctacggttgttgctgccgtggat
caagccatggtgagagagccagctccaagtgttgtagagcaagctgctaaaaggacagct
atgactgcagtccatgttcagcctgttcaggagcagatgagaaaggaggcaacggtagta
gttaccagtgataaagctacaaaacaaacagtaatatcaagaactagagaaggaattgtt
acttcacaagaacaaagacacatctctcgcgaaaaggtaagaaaagaaccagagaaaact
ccagtacccacagtaataattgccacagacaaagccaaagaacaagagagaatatcaaca
gctagagaagaaatatcagtccgacatgagcaagtgcatgtttctcatgagcaaataaga
agggaagatgtgaaaccttctgtaccaaaggtggtgattaccactgataaacctaaagct
ccagtcttaatatcaaaaagtaaagaaggaattgcaaccaaacaggaacgtgtgagcata
agccatgaaaagattaaaaaggaagctaagaaaactactgtagttccgaaaataattgca
ccagtcacagtgcccagaactagagaagaaattacagccaagcaagaacaaatgcatcta
gcttatgatcagattgaagctggaaaaagggctgaagctgtagctacagttgtggcagcc
gttgatcaggcgcgtgttagatcaccttgggagacagagcaagtagatgaaacttacgtc
aagcagaaaactttggaatatggttataaagagcatgctgtaaaagaccatgaggcacaa
gcagagcaccgtgttgctactaaagaagttaaaacagtctacattcctcctgagaaacat
attccagctgctgaaaagaaggaagttcatgtatcaacagagattaaaagagaaacagaa
gccaagattgagaagacaatccacatagaacacccgcgaccccgcacagcaagtcctcac
ttcactgtctccaaaattgctgttcctaaaccagatcatacatatgaggtttcaatagca
ggatctgccatggctactctggaaaaggagttatctgctgcttctgctgcacaaaagatt
accaagcctgtgaaaccacctcagctaaagccgcatgaagtcaagataaaaccagagtca
gctcctccacaatttcccttcacagaggttgctgagacgaaaaaagaggtggatgtaagc
attaaaggtgaagcagtgcgggaggatcacctgctgttgaggaaagagagtgaagcaaag
gtgacagaaactgccagagttcctgtgcctgcagaaattcctgtgactccacccacctta
gtctggggtctcaaaaataagactgtgactgaaggtgagtctgtcactctggagtgccat
atctctggtcaccctcagcctacagtgacgtggtacagggaagactacaagatagagagc
tcaatggacttccagatcactttcaaagcaggacttgctcgccttgtgattcgtgaagcc
tttgcagaagacagtggaagatttacctgcactgcaaccaataaggctgggagtgtcagc
acatcttgccacttgcatgtgaaggtttcagaagaaactgagactagagaaactatttct
gagaaggttgttacagaagagaaaagctatgtggagacaaaggatgttgtaatggaagat
gtctctgctgcagctgaggaagtatcgggagaacctgtacctcctttcttcataagaaaa
cctgtagtacacaaattaattgaaggtgggagcattatttttgagtgccaagtagggggc
aacccaaagccacatgtcctctggaaaaaaggtggagttcctcttacgactggctacaga
tacaaagtaagttataaacgagaaaccggggaatgcaaacttgaaatttccatgaccttt
gccgacgatgccggagaatacactattgtcattcgtaacaaatttggagaagcttctgca
acggtctccttactagaagaagctgattatgaggcctacataaaatcccaacaagaaatg
atgtaccaaactcaagtgactgcatatgtccaggaacccaaagtggctgaggtagcccca
cctatttcatatggtgactttgataaagaatatgaaaaagaacaagccttaattaggaag
aaaatggccaaagatacagtggtggtcagaacttttgtggaagatgaggaattccacatt
tcttcttttgaagaaagacttatcaaggaaattgaactcagaattattaagacaacctta
gatgaactcctcgaggaagatggagaggagatgatggttgacatttctgaatctgaagca
actgaagcaggatttgatttaagattaaagaattacagaacctttgaaggcactggtgtt
actttccattgtaagacaactggatatccattgccaaagattgcatggtacaaagatggt
aagcgcataagacatggagagcgctaccacatggaagttctgcaagatggtagtgccagt
ctgcgtttgcctgttgttttacctgaagatgaaggaatttacactgtctttgccagtaac
atgaaaggaaatgccatttgctcagcaaagctgtatgttgagccccttgcacccacagca
gctccaggttatatgccaggaccagaagttatgagaagatatagatctatttctccgcgc
tctccttctcgttctcctgcccgcagctctccttcccgttctcctgcacgcagattagat
gaaacagatgaaggacaactagagagactatataagccagtttttgtgctgaaacctaca
tcagtcaaatgttcacaggggcagacagcaagatttgacttaaaagttgttggcagaccc
atgccagagacatattggttccataatggtcaacaagtggttaatgattacacccataaa
atagtgattaaagaagatggtacccagtcattgatcattgttcctgctatgcctgaggac
tctggtgaatgggctgtaattgctcagaatagggcaggcaaagcttctgttacagtcaca
ctgtctgtggaagctaaggaggacctagtcagaccacgctttgtggaaaggctcaagaac
gttagtgtaaaagagggctctagactgcacatgtctgtgaaagcaactggcaaccctaat
cctgacattgtgtggttgaagaatagtgacatcattgtaccacacaaatatcccagaata
aagattgagggaacaaaaggagctgctgcccttaaaattgaatccaccgtcaggcaagat
gctgcatggtatacagctactgccatcaacaaagctgggcgggacactactaggtgcaag
gtgaatgttgaagttgaacatgctgaaccagaaccagaaaggagattaatcattccaaaa
gggacttacaaagccaaggagattgcagcaccagagttagagcccctccatttgcgttat
ggtcaagagcagtgggaggagggggatctttatgacaaagaaaagcaacagaaaccattt
tttaagaagaagctcacatcattaaggctgaagcaatttggaccagcacattttgagtgc
agacttacaccaattggtgacccaactatggtggtggaatggttgcatgatggcaaacca
ttggaagcagctaatagactccggatgattaatgagtttgggtactgtagcctggactat
ggagtagcctattccagagatagtggtgtgatcacttgcagggcaactaacaaatatggt
acagaccatacatctgctaccctgattgtaaaggatgagaaaagtcttgtggaagaatct
caattgccagaaggcagaagaggaatgcagcgaattgaagagttagaaagaatggcacat
gaaggtgctcttcctgcagttgctgtggatcaaaaggagaaacaaaagccagagcttgtt
ttggttcctgagcctgcaagagtcttggaaggtgaaacggcacgattccgctgccgtgtc
actggttatcctattcccaaggtcaactggtaccttaatagtcagctcattcgtaagagc
aaaaggtttagactccgttatgatggaatccattacctggatattgtggactgcaaatca
tatgacacaggtgaggtgaaagtcactgcagagaatccagaaggctttattgaacataag
gtgaaacttgagatccagcagagggaagacttcagatcagttcttcgtcgggctcctgaa
cccaggcatgaacctgtagtgacagagcctggaaaacttctctttgaggtacagaagata
gacaagcctgctgaggcaacaaccaaagaggtagtgaaacttaaaagagctgaaagaatc
acacatgagaaactgtcagaggaatctgaagagctgcgcagtaagtttaagcgaaggaca
gaagagggatattatgaagccatcactgctgtggaacttaagtctcgcaagaaggatgaa
tcatatgaggagatgctaaaaaagacaaaagaagaacttcttcactggaccaaagagatc
ccagaggaagaaaagaaagcccttcctcctgaaggcaaaatcaccattccaacattcaaa
ccagagaaggttgaacttagtccaagtatggaagctcccaagatatttgaacgaattcaa
agccagactgtagcccaaggcacagatgcccacttccgtgtgagagtggtagggaaacca
gaccctgagtgccagtggttcagaaatggtgtgcagattgaaaggactgatcgtatatac
tggtactggcctgaagataacgtttgtgaactggtcatcagagatgtgacttctgatgat
tcagccagcatcatggtgaaagcagtcaatatagctggtgaaacttccagccatgctttc
ctgttggtgcaagccaagcagctaattagcttcatccagaacttacaagatattgttgct
aaagagagggactccatggcaacatttgaatgtgagacatcagaacccttcatcaaagtg
aaatggtttaagaatggaattgagattcattctggagaaaaatacaggatgcactcagac
agaaaggctcattttctttctgtactagcagtagaaatgtctgatgctgatgactacagc
tgtgcactggtagaagatgaatctgtaaaaactactgcaaagcttactgttgaaggtgct
gtggttatgttcattaaagaacttgaggacgttgaaatcccagaatccttcacaggtgaa
cttgagtgtgaagtttccccggaagacattgaggggaaatggtatcatggtgatgttgaa
ctcagttccaatcataaatacgtgcttgcatcccgtcgtggtcgccgaatcctcactatt
aaagatgttaataaagatgatcaaggagagtatagctttgttgttgatgggaagaggact
cactgcaaactaaagataaagcctcgtcccatgactattcttgaaggacttactgatcaa
aaagtctgtgagggagatattgtacaacttgaagttaaggtttctctagaaaatgtggaa
ggtgtctggatgaaagatggtcacgaaattcaatcaagtgatcgtattcatattgtgttg
gataaacagtcacacatgttgttgatagaagatgcaacaaaagaagacggtggaacttat
tctttcagcattcctggtcttgaactatcaaccactggacaagttactgtgtacagtgtg
gaaataatagttcctctaaaagatgttcatgtagttgaaggaacaaaggctattctcgaa
tgcaaagtttcagcaccagatgtaacttcctccaaatggtacctaaatgatcaccagata
aagcctgatgaacgtgtgcaagctgtgtgtaaaggcactaaacagaggctagtggttacc
agaacccacgcatcagatgaaggacattacaagttaatggttggcaaagtcgaaacaagt
tgcaacgtcacagttgaagaaattgagattatcagaggtcttcgtgatatcacctgcact
gaaacacagaatgtatcttttgaggttgagctctctcattcagggattgatataatttgg
catttcaaagggcaagagatcaaggctggtcctaaatacaaaattgaagtacatggcaaa
atatataaattgacagtggtgaaaatgatgaaagatgatgaaggagaatatgtattttat
gctggagggaagaaaacatctggaaaattgatagtggcaggaggtgccatttcaaagcct
cttactgacctgactgtagctgaatcccagagagctgtttttgaatgtgaggtggcaaat
cctgaatcagagggccagtggctaaaaaatggtaaaccattacccaggacagatcagtat
cgtgctgaaactgatggtgtaaagaggagacttaatatccctgccacaaagatggatgat
atgggtgaatatagctatgaaatagcaagctcaaagacatctgcaaaactgcatgtcgaa
gctgttaagataaagaagactcttaagaacttgactgtgacagaaacacaggaggcagtg
ttcagcgtagaactttctcaccctgatgtgaaaggagctctgtggattaaaaatggtgtt
gaacttgaatcaaatgacaaatacgaaatttcagtgaaaggaacagttcatacactgaaa
atcaagcactgtgttgtcactgatgagtctgtttatagctttaagcttggaaagatagga
gcaaatgccagacttcatgttgaaactgtcaagattatcaagaagccaaaggatgtgact
gctttggaaaatgctgttgtttcctttgaactgagtgtatcccatgatactgtaccagtt
cggtggttccacaaaaatgttgagctgaaacaaagtgataaatacaagatgatatcacaa
aggaaagtccacaagctgatgctgcataatatatctcctgctgatgctggagaatacaca
gcttttgttggacaacttgagtgtaaagcaaaactatttgtggaaaccatacacatcaca
aagaccatgaaaagcattgagatccctgagaccaaaactgcctcttttcaatgtgaagtt
tctcatttcaacgtacctgctgtctggttgaaaaatggtgtggagattgaaatgagtgaa
aagttcaaaatagtggtccaggggaaactccatcagctgaacatcatgaacacaagcagt
gaagattctgcagaatatacatttgtctgtggaaatgacagagtcagtgcaactctgacc
gtaaaacccatcctaataacctccatgctcgaagacattaatgctgaagagaaagataca
atcacatttgaagttactgttaattatgaaggtatctcatataagtggctgaagaatggg
gtggaaataaaatctactgacaaatgccagatacgaacaaagaagctcacacactcactc
tccataaggaacgtgcattttggcgatgctgcagaatacagttttgttgctggaaaagca
gcgtcatcagccactttatacgtggaagctcgtcacattgaatttaggaagcatattaaa
gatattaaggttgtggagaagaagagagccatttttgaatgtgaaatttcagaacctgac
gttcaagtccagtggatgaaggatggacaagaacttcagattggtgaccggatgaaaatt
cagcgggagaaatatgtccatcgtctcatcattccttccacaaaaatgtctgatgctggt
cagtacactgtagtagcaggtggaaacacatccagtgccaatttgatagtggaaggtcgt
gacattcgaatcagaagcatccgtaaagatattcaggtcattgagagacaaagagctgaa
attgaatttgaagttaatgaagatgacattgaaccacagtggtacaaagatggcattgaa
atcaacttccattatgaggaaagatatagctatgtggtggaaagaagaattcatcgcatg
agcatctttgaaaccacttattctgatgctggagaatatacttttgttgcaggacggaat
aggagttctgttgttctctatgtgaatgctccagagccaccccagattatccaggagcta
cagccaaccaccgtggagtcgggtaaacctgcccgcttctgtgcagtgatatcagggaaa
ccccagcccaaagtttcctggtacaaagatgatcaacagctttctccaggtttcaagtgc
aaatttcttcatgatgctcaagaatatacgctgttgctgattgaaactttccctgaagat
tcagctgtgtacacctgtgaagccaaaaatgactatggagttgctacaacttcagcttca
ctttcagtggaaatcccagaagttgtttctcctgagctagaggtgccagtgtatccacct
gctgtcatagtaccacttcgtgatgctgttacatccgagggacagtctgctcgttttcag
tgcagagttacagggacagatctgaaagtctcttggtatagcaaagacagagagatcaag
ccatcacgtttctttagaatgactcagtttgaagacacttaccagctggagattgctgaa
gcttatccagaggatgaaggcacctacacctttgtagcaactaattctgtgggccaagtg
acaagcactgccaccctgaagttggaaggatttaaaaaggttgaagaacttacagcagag
tcccactggcatgtttcttcatctgtttcacttaaggaggagactattggccaaaggccc
atctttatccagcctatttcatgctgcagggtctgcagtggggaaacagtcagatttcaa
gctagagtatctggcatgcctaaaccagaaatccagtggtttcataatcaacagctcatg
cttccagcaaaagacttagtgttccactttgatgagtttacaggcacagttatgctcata
atagtagatgcttttctagagcatgctggccagtactcttgcaaggcaagaaatagtgct
ggagaaacaacttgtacagctacccttacagtgacggcagaagtgcaagccctagatagg
caaagttctgggaaagatgtaaaagagtctatgcggtcacaggctatatcagaacttcat
gttactcctttcacaaagaagaatatgaaagcttttcgaaaagaatttcaatcaatgcaa
caaccatcacaggaatcgggtgtacaggtttttaaaagcatatctgaaaggttgaccatg
aaagctacatcagttgaagaagaagaagccatgcacacaacagtcctttcccagacatct
cagagcaccagaatctctatgtctactgctcaagaaccaaaaggtgttcctccagcgatt
ctcctgcaactcagagacctaactgtgaaatctggtgacatagctcagttcatatgtgct
ttagaaaatgaatacttctctgagtttctttgggcccacgaaggtaaacggatagaagtg
tcagaaaaattgaagatatcacaaaatggaagtgtcctacagctcacaattttaaatgct
cagctgatagatcaaggactatacagttgtactatatataatgattacggaggaacaaca
actgctgcaatactaacagtcaaaggtgctcctgaaaaaatcatgtatgagaagctagag
gaagagattgaaatggaaatgaaagacatctctagttctcttactgtgtcttctgaggaa
ggaagaagtgaaggctacagcagcagccttcagttgcctgatagagaaaaaacacttgaa
tttgagtctgaaaaaccagtttattccagtcaaaacaaccagaaaatggaggaggggggc
agtgcacctgttttcctcagacaggtctcagatgttgaagtttggcagggagatgtagct
aggctgtctgttactgttactggaagccccacaccgaaaatccagtggtttttcaacggt
gtgaagctaaccccctccacagattgtaaattagtgtttgctggaagtgaccacagcctt
atcctcccctatgcaggcatgcaggatgagggcaagtacacatgcacagccagcaatgtg
catggtgaggccacatgcagtgcccacctccatgtgcagcagcgggcacaaggggcccct
tgctttgccagggtaccagacagtgtgcagtgtgcaccaggtttcaccgctgtctttgag
tacactgtggctggggagccatgccctgatgtggagtggttcaaggggaacgagcaactt
ttcttggatgcacgttcttttgtggctcaccatcctgacggctcaggctccctgacagtg
caggagtgcactgaggaggatgctgggctgtacatttgccgggcagtgaactcactgggt
gaggctgcatgctctgctgagctcctggtgttgcctgaggagcatcttgtgtgcaagcag
agtccagccttgcagcactccatggtgacagaggaccaaagtcctatgtcctatgaagag
gtcagcgagcttcccacagcagaaagagcacttagccttgaggccatgagagaaccccag
gccctcctccagctccagataagccagatggagcacatgctacccaaggagggcatatta
cctaggctgccgccaacctgcctcgctgtgcagggtgttgaagaaatgctgacccaggca
gccacaacgcaggagaacaacaagcttctggcagagctggtgcagactctccctggtggc
ccccaaagtgtttcacctgaagtggcaactgaaacaccactgccaggctcccttggaact
gtggctgcacagatgctcttgcccaaagagcaaatcatcccagaggagttagaacagaca
gctgctctgaagacagaagtttcccaagcccttcaacaggtatcaagcaccactgagagc
tgtgtcatgtatggtgaccactttgaagtcatagaaggcttccaggcaatgcaaggtgag
ctaaagtctgaacccagatttccctccgaattggcctgcacaggaggtcatgctgtcccc
ctggagaacatttctgccctggaagcagcagaggaagattttgctgcaagaatctgcgag
ggacaggctgtgagatttcccttactactagaagaaaaacagcctttggaggaagaacat
gtcgtcaatcttgccagcccacttaagcagtatccaaaggtaggaagacagccccgtgaa
atgatgtatgctagccagttccagacaagccaagcctttaccaaagagagccagctcact
tatcaggttcccaagagctgtcacctagatatgaagtcccaaatcagagatgcactgaaa
gctgcagtggtgagtgagcaaaacctcttgttttcagaatggttggctgataaaagaagc
gttgaagtacagacattaaaaatcaccaaggaacataaatacgccttatgcacctatgtt
gtgaccacaggaggactcaatcccattgaaattccagtctctcttgcagaagtcgacatt
gagacagctgaccagaaaaaagtattaaaggaggctttctattctcttatttatgaagaa
aagcacctcttgacagatgaaaaacccaaagcattgccaagccctccccattcactttat
tcaggaaaatccattgatgaaacttctcagccagagccccaacaggctgagagaactaca
gaggcagaaatacctttggaacagcctttgtctgctgaagtagtcaacattctgatggaa
catggccaaatcaaggatgtgggggcagcagcagccactgctgatgtagcccctgcaggc
attcctgttgagaaacccacagaaatactaaaaaggaaggagaaaagggaagaaatatat
gaggaggagggcagagagggtctggaaactaaaggtgtgaatctagaggatgagttaagt
aaagagaattaccctatcatacacagcaagctggccaacactattgtggaggaaggggag
agtgtcactctggtgtctgtcgtaacaaatgtcagagaggtgaattggtactttgacggt
aaactggtgtcttcaggcaacaaattcaagtgtttgcaagatcaagacacatacaaacta
gtgatcagccaagtgtgtggggagatccaccaaggagagtacacttgtgaggcactgaat
caaggtggaaaaagaacaacaacagcaaagctcacagttgttaaaagagttgcaccaatc
ctgagaagaaggctggaacctctggaggtggccgtaaaccacatggccaagtttacctgt
gaagtagaaactactcctaatgtcaagttccagtggtacaaagctggccgagagatctat
gatggggacaaatactcaattcgctcctccaattacctttccatgctggagatcccaagg
cctcaggttgttgactgtggagagtacagctgtaaggcttccaaccagcatggcagcgta
agctctacagcctttttaacagtaactgaagcacttccgccaacgtttcttaccagacct
gaatctatcaccacttttgtgggcaaaagcgccaagttcctgtgtactgtttcgggcact
ccagtcattgacgtcgcctggcagaaagacggcacaaccatttcatcttcggaccactac
aagatctccaaagtagaaaacaagcacgtgttagaaatttcccttctcaccaccagtgac
agggggatttacacctgcaaagcttctaataagtttggggctgacgtttgccaggctgaa
atggttattatagacaagcctcattttattaaagttttgcaatcagtgcagtcagcggtc
aataaaaagatacgtcttgaatgccaggtagatgaagataggaaagtaagagtagagtgg
acaaaagatggaaacaaaatccccccaggcaaagattataaaattttcttcgaagacaaa
atagcctcacttgagattcctctggctaaactcaaggattcaggccattatgtatgcatc
gtctcaaatgaggcaggaagcagctcctcttctgccagtgtcacagtcagagaaccacca
tcctttgtgaagaaggtcgatccatcttatttactgaccccgggtgactctgcacggctt
cagtgtaaaatcaaagggtctcctgaaatccaggtttcttggttcaaggacaataagaaa
atccttgaaagcaacacacacaagatgtcttttgtcaattttgtggctgtgttagacatc
tcggagatgaaggttgatgacagtggaagctattcatgtgaagctgtaaatgaggttgga
agcgacagctgcaccacagaagtagttgtcaaagagcctccatctttcgtccgaacactc
gaaccagcagaggtagtgaagggaacaaacaccgttcttcagtgtgaggttgctggcact
ggaccatttgagataagctggtacaaagacaagaaacagatccggagtagtaaaaaatac
aggttgacctctcagaaagcagttatttctctggaggtgtcgtcttttaatagtgcggac
gttggtgaatacgagtgcgtgatagctaatgaagttggaaagtgcatatgcagtgcaaca
tatgtcttgaaagaaccaccatctttcgttaaaaaaattgaaaatgtgacagctctggct
ggagacaatgttacgttacaggctgtggtaaaagggtcagaacctatttctgtgatgtgg
atgaaaggcaaagacattattcacgatgataacaaagtgagagtgacatttgaacacggg
ctagcaacactgcaaattactggtgtccagctgagctctggtggcaaatacacttgtgtg
gctgaaaatgatgcaggaagtcagtcctgttttggtgaactggcagttaaagaacctgcc
aaaatcattgaaaaatccgaagtgattcaggtgacagcaggagacccagccattttggaa
tacactgtcacaggcactccagagctaaaaaccaaatggttcaaagacggaaagccacta
cctgccagcaaaaagtacaggatcagctttaagaacaatgttgcccaactcaagttttat
gctgctgaaatgcaggacagtggcgagtacacctttgagatatccaatgatgtgggaatc
agctcttgtactaccagctttactgtgctagatcgcactctccctcccttctttactaaa
ccactgaagaacattgacagcatcattagcacctcgtgccgcctagactgcaaaatttct
ggctctcttccaatgactgtctcttggtttaagcaagacactgagatcactgcaagtgcg
aagtacacaatacactttgcagaaggctctgcatctttggaaataaaacacctagatgca
agtgatgctggagtttatatttgcagagccacaaactctgctggtagcaaagacagcagt
agtactttgtttataaaagagccacccagcttcattgcagaaccagagtcccaggatgta
ctgcctgcgtcaactgtacgtttcaagggtacatttaaaggcactacaccgctgacagtg
aaatggtttaaaggtgatactgagctgataactggaggagcctgctacattatgacagag
gcgttagcaagttccttagagctttacgcagtcaaaccaaacgactcaggaaaatacatc
tgcaaagtctccaatgtagctggttcaataacatccattgcaaacttgtttgtaaaagaa
cctgctgcttttacggagaagctagagccaactcacctggtgaagaaaggtggatatgct
gaactgacctgtaaagtcactggtactcctgagattaaaatcacatggttcaaggatgat
agggagctaaaagagagtgacaaatttaggatgtcttttacaaaatctttggcagtactt
catcttacagatgttgagactgaagacagtggggaatatatttgtgaggccagaaatgat
gctggaaaagatacttgcagcaccattgttacagtcaaagagtcaccttattttagaaag
gagtttcaatccatggaagtcttgaaggattctgatgtgattttggagtgtgaggtgctt
ggtacacctcccttcgaagtgttttgggtgaaggatgataagcctgtgcggagcagtaag
aaacatagaataagcactgagaaatctttgattagcctccatgtcttcaggtttgatgca
tctgacgttggtgaatatcagtgtagagtaacaaatgatgtgggaagctgcctctgcagt
tcagaggtcacactgaaagagcctccccagtttttgaagaggatagaaaacattagttct
cttcgagggggcacagtcgtgtttcaggctgctgttaaaggctccttgcccatcattgta
tcctggctgaaagacagtgatgaagttattgaagacagtaatatcaaaatgacctttgtg
aacaacattgccactcttctggtgaagtctattgaactgaaacatgatggaaaatatttc
tgccaggctaaaaatgaggcaggaattcagaggtgctctgctctgctgactgtcaaagag
cctgctacaatcgtggataaggctgtgtcaatagatgtgactgagggagacccagcaacc
ttgcaatgtaaattttcaggaacaaaagatattacagccaaatggttcaaagatggcaag
gaattgactttaggcccaaagtataagatcagtgttacagatactgtctcagtcttaaag
gtacttcatgcggaaaagaaagatagtggggagtatgtatttgaggttcacaacgatgtt
ggaagaagtagctgttctgctagcatcaatgtcctagatctcattataccacctaaattc
accaaaaagctcaagaaaatggacagcattaagggatcttttgtccacttggaatgtata
gtgtctggttcacatcctataagtatccagtggtacaaggatggccaagaaataacaaca
agtgaaaagcacaaatactctttccatgataatactgcctttctggaaatcaataaactc
gaaggcacagacagtggctcttacacttgtgaagcaacaaataaggcaggaagcaaccaa
tgcagtgggttcttaaccgtcaaagaaccgccatattttgtggaaaagcctcagtcccaa
gaagttgtgccccatgctagggttcagttcaaagcattggtgaaaggctctactcctctg
cagataaagtggtttaaagacagccaggagctcctttctggagctaatcgttctgtctgg
atggatgacacatctagtgtgctggagctcttctcagctaggatgtctgactctgggaac
tacacttgtcagataagcaatgatgtgggaactgcaacatgtaaagcaactttgtttgta
aaagagccccccaggtttattcagatgccaactcctgtagtagctttgcgtgaaggacag
tccactacttttgagtgccatgtagtaggaacaccagaaatacatgtcacgtggtacttg
gatgggaatgaaatgactgatgaagctaagtacgccatctctttcattgatggtctagcc
actttgaaagtcactcaagccagagtgtcggatagtgggatttacgtttgtgaagcccac
aatgatgcaggtagtgagagctgcagcatcgagttgaaagtgaaagagcctccaacattt
gttcgagagttgagacctactgaggtagtgaagggtttggatgccatgctcgagtgtgag
gtgactggtactcctccatttgaggtgaagtggctgaagaataataaggagatgttcagc
agcaagaaatatgctatctccaccaaagaatcaatatttactcttaatgtgaccaactgt
gacacctcagatgtaggtgaatatcagtgcattatatcaaacgaagttgggagctgttct
tgtagcacaaggctcagcttgaaagaaccagcatcctttgttaagaaactggagaatgtc
actactgttttgaaaggcaccgcatccttccagtgtgtcgtagcaggtgctcaaccctta
tctgtgtcatggataaaggatgagaaaatactggaagatgatgaataccaccacattacc
tttgagaataacgtggccacactgaaacttaccaatgtcgacctcagccacagggggaga
tacacctgccaggcaaagaatgaatctggagtggagaaatgctttgctttactttttgtg
caagagcctgcacggattatagaaaaagctaaatcacttaaagttactgaaagagaccct
gtgactttggaatgtactgtggaggggacaccagagctccgaataaaatggtacaaagat
ggcaaacagcttctacccagtagatattacacaatgagctttgagaacaatgtggccagt
ttcaggattgaacctgtatcgaaggaagatagtggtacatacagttttaaggttgaaaat
gacttcggaagtagcacctgcgaagctattctgactgtgctagatcaagcaattcctccc
ttatttatcaaaaagctaaccaaaaaggatacggttctgggatcttctattcagatggag
tgcaaagtctctggatcacttcccatttctgcaaagtggttcaaggatgggaaagaaata
actgacagtgcaaaatatagaagcctgtgccacgagaacaccatgtcacttgagattgct
aatctagagctgacagacactgcaaattacacatgtaatgtctctaacattgccggaagt
gattcttgcagtgctgtcctgacagtgaaagagccaccaagcttcttagtaaaacctgaa
agccagcaagccatcccagattccatggtggaatttaaggccatactaaaaggaacacca
ccatttacagtgaagtggttcaaagaggatttagaacttgtatctggtccaacttgtttc
attgggattgaagggtcaactgggttcttaaccctctattcggtggattcttctaggagt
gggcactacacttgccatatttcaaacgatgttggcagtgactcttgcactacaatgttg
atggtaacagagccacccaagtttgctaagaagctagaggcaacaaaaatagtaaaacag
ggtgactcagcccggcttgagtgcaaagtaagtggatctccagaaatgaaagtagtgtgg
ttcagaaatgaccatgaaattgttgccagtgaaaaattccggacctcattcatcgactct
gtggccgtacttgaaatgaatcatctcagtacagacgagagtggagactacatctgtgaa
gctcagaatcctgccggcaaggccagctgcagtaccaaagtcacagtgaaagaacctcct
gtgttcagcaggaagccttctccagtagacatgctcagaggaactgaggttagcctggaa
tgtgagatttcaggaacaccaccatttgacgttacctggtacaaagacaagagacaaatc
cgcagtagtaagaagtataaggttacagcaaaaaactaccatacaagcattcgcattctt
aatgttgaagttgcagatgttggtgaatatcagtgcaaagctcagaatgacgtaggaagt
gacacttgtttctgcacgatgaagctgaaagaaccgccgaaattcgtgacaaaaataaac
agcatgactgttgtggttggtgaaccagtggagttacaagcaagagtggagggctcccag
ccgatttctgtgcagtggcttaaggacaaggaagaaattattagagaaagtgaaaacaca
aagatcacatttatggaaaatattgcaactttacatcttgtacacacagaaacaagcagt
gctgggaaatatatctgccagatcagaaatgatgctggaagtcgcgagtgtatggctacc
ttaactattctagagcctgcagtcattgtagagaaggcagagccaatgagggttactata
ggagatgcctgtactttggagtgcaaagtggcaggcacaccagaactatccactggatgg
tttaaggatggcaaagaactgaccagcagccaaaaatacagaattactttcgtcaacaaa
gtatctacacttaaaattctggacacagagaaggaagatggtggattgtatacttttgca
gtgcaaaatgatgtggggaaaagcagttgcacggcatctgttgaagttttagatcgaata
attcctccttctttcacaagaaagctaaaggaaacccctggtgtcctgggttcctcagca
ctgcttgaatgcaaagtggctggttcacctcctatatctattgactggttccaaaatgga
atgaagttagttagtggggaaaaacataatatctcatttactgataacctgtgtatttta
gaagtgaattcactgagcaattcagatactggaacttacacctgcaaagctaccaatgta
gctggctcggatgaatgcagtgctgtactgaccgtccaagaaccaccatcttttgagagg
atacctgagcctttggatgtcttgccaggcacaagtgtaacttttacaggtgttatcaga
ggaacccctccttttaaggtgaactggtttagaggagccagtgagcttgtgccaggggac
aaatgtaatatctacttagaggattctgttgtggagcttgagttatttgatgtaacccct
cttcaaagtggagagtacacttgtctagtgactaatgaagctggcagggcaaattgtaca
acacatcttacagtaaaagaaccggctgtctttgtgaagaaactgagtgatcaatatgtg
gaacctggtaagcccatcatcctggagggcacatacacaggcagcttgcccatctctgtg
acatggaagaagaatggccacacactcgctcagtctcacaaatgcagcatcactaccaca
gagaaatcctgcatcctggagatccttgacagcacgaaagaggatgcaggagaatacacc
tgccatgttgaaaatgaggcaggaagagatgtttgtgaggctgtagtctctactctagaa
cctccctattttgttacacacttggaacctcttgaggtgtcagttggggattatacaaca
ttgcagtgtcacgttgctggaaccccggaaattactgtgtcttggtacaaaggtgataca
aaactcaggtctactcctgagtacaaagtgttctttaaagacaacattgcttccctcact
ttcaacaaagtggttatcaatgacagcggcgaatatatctgcaaggcagaaaacagtgta
ggaactgcatctacaaaggctctcttaacagttcaagaacgcaaacgaccaccttccttt
gcaagaagattaaaagacatcgaacaccctgttggtttaccccttaaacttatgtgtcga
ctcaatggctcagaacccatcactgtgacttggcataaagatggtgtgcaattaagtgat
gaccacagtgtgcacacatcctttgtagataatgttgcagtgttgcaactggtgcaaaca
gagatgaatcacagtgggcaatacacctgcacagccactaacgctgtgggcactgccaac
acaagtgctaggcttacagtgacagaacccaagcaagcacctgtctttgatactaagcca
gaatctattgatgtgccttttggagaaagtgctgattttgaatgccatgttactggagcc
cagccaatacaaatcacctggtccaaggatggtcgggagatccgaactggaggaaacttc
aatattacttttgtagcaaacacagctcatcttcgagtgctcagagtgggtaaaggagac
tctggccaatatacttgccaggctagtaatgaagctgggaaagacttttgctcagcccaa
ctcactgtgaaagaacctcccaagttcatcaagaagcctgaagctttgcagtttgtgagg
cagggagacacagttcaacttgaatgtaaaatcactggcacaccagagatcaagatcaca
tggtacaagaatgatcaggcactccaggcgagcaacaggctccacatgtcctttgtagaa
tctacagcagtgctaactatcttggatgccagcgctgaggatgccggtgattatatatgt
gaagcccaaaactctgccggtgctgccagctgtagcacttcagtatccgttaaagaaccg
cctgtttttagcaaggtgccgagccctgtggacacacttaaaggctcggatgttatcctc
cagtgtgagatagcagggactccaccctttgaggtggcttggttcaaggaccggaggcag
gtccggagcagcaagaagttcaaggtaacagcaaagcactccattgccagtcttcacata
ctcagcctggaatctcaagatactggagaatatcagtgcaaagcaatgaatgaagtgggg
agtgacacttgcacctgcccagtgaaattcaaagagcccccacgtttcaccaagaagctg
agtgacactgcaatcttcgttggagagccaacagccctgcaggcagtggtggaagggtcc
ccaccaatttctgttgtatggctgaaagacaagggtgaagttattagggagagtgaaaat
gtccaaatgtggtttatggacaatattgcaactcttgagattgccagtgctgagggagct
gatgttggaaagtacatctgtcagattaaaaatgatgctggcatgagggaatgctctgca
tttttacaagtcctagaaccagcagtcatcttggagaagactgagccgatcacagtgatg
gcaggcaacccttttaccctggagtgcagagtaggagggacgcctgaacttatcaccaag
tggtataaagatggcagagaactgaggagcgaccgcaaataccaaattacctttttcaac
aatatatctactttgaaagtcttttctgcagagaagagtgacaggggcttgtatactttt
gaggtgcacaatgaggtgggggacagcagctgcacttcttcagttgatgtttcagatcgc
cttgttcctccttcattctcaagaaaactaaaggaaacaaatggagtgctgggatcctca
gtgctactggagtgcaaagtgtctggcacatcccccatgtctgtggcctggtttcaggat
gggaatgaaattgttggtggggaaaaatatgaaatctcattcttggataacatttgtgct
ttgaagctgaatgccctggatgttacagatacagggccatatacttgtgtggcaactaat
gtggctggatctgatgaatgcagtgccttcttgactgtacaagaaccaccttcttttgtg
aagacacctgatccccaggaagttttgcccggatcaagtgtgacattcactagccatatc
aagggcagcacgcccttcaaagtcacctggttccgaggcatcagggagctggtgccagac
agcacctgctccatttctctggatgagtctaaggcacagctgcagctgttcaatgtggag
ccagggagcagtggggactatgcctgtgtcgtcacaaatgatgctggcagtgcctcctgc
acaactcaactctttgtgaaagagcctgcagtcttcatgaagaagttaagtgatttcagt
gtagagcaagggaaatccattgttctggaaagcatctacacgggtacccctcccatctcc
gttacctggaaaagaaatggcatgccaatagctcagtctcaacgctgcagcgttacaact
actgacaaatctggcattcttgaaatcttcaacagcaccaagagtgatgaaggcgaatat
acctgtgaggtgtcaaatgaggcgggtggggatgtttgtcacagccttgtatctatctta
gaaccaccctatttcatcacacacctggaccgtgtggaggtgaagattggcgagcccttg
gttttaaaatgccagattggtggtgcaccagaaatcaaggtgtcttggtacaaagaagac
accaaactcagatcaacacaggcttacaaaatgcacttcaagaataatgtggccacgctg
gcattctccactgtggaggacggtgacattggagaatatacctgcaaagcagaaaacagt
gttggctttgctacctccacagctttgcttgttgttaaagaacgtcaacttccacctaca
tttgccaggaaactgaaagatattcaggagactgttggtgctccagtgacttttgattgc
cgtataaatggctcagagcctatccaggtctcttggtacaaggatggggttctcttaagt
gacagcgataatgtgcagtcaaccttcttaaacaatgttgcaactcttcagatcttgcaa
actagtatggcttactgtggccaatacacttgctcagcccaaaatgccctgggaactgca
tcttccagtgctaagcttctccttacagaacatctacaaccacccttctttgacatcaag
ccagtatctattgatgtggcactaggggaaagggcaacctttaagtgccatgtgactggc
tccgcacccatgaggattgtgtggaccagagacaacagagagatccgcccaggtggcaac
tacaagatgatgctggtggaaaacacagccagcttggtggtcctaaaagtgggtaaagga
gatgctggactctacacctgtactgccagcaacagtgttggaaaggatgcatgcgccgcc
cagctggctgtacaagaaccgccaaggtttattaagaaactagactcttcaagacttgtg
aaacaacatgattccactaggtatgagtgcaaagtaggtggatctcccgaaattaaagtc
acctggtacaaaggagaaactgagatccatccaagtgaaaaatatagcatgtcctttgtg
gattcggtggcagtccttgaaatgcacaacctcagtgttgaagacactggtgactacagt
tgtgaagcccagaacccagctggtagtgctagcaccagcacctcactgaaagtgaaagca
ccccctgcttttaccaagaagcctcatccagtccagaccttgaaagggtctgatgttcat
ctggaatgtgagcttcagggcacacctccattccagatttcatggtataaagacaagcga
gaaattcggagcagcaagaagtacaaggtcatgtctgagaactaccttgctagcattcac
attctcaatgtggatactgcagatgttggtgaatatcactgtaaagctataaatgatgtg
ggaagtgactcctgcattggctctgtaacactgagagcaccaccaacctttgtgaagaag
ctgagtgatgtcactgttgtggttggggagacaattgaactacaagctgcagttgaagga
gcacagcccatttctgttctgtggttaaaagacaaaggggagatcattagagaaagtgaa
aatctttggatttcctattcagaaaacgttgcatctctgaagattggaaatgcagaacca
accaatgctgggaaatacatctgtcagataaaaaatgatgccggatttcaggaatgcttt
gccaaactaacagtgctcgaacctgcagtcattgtagagaagcctggcccagtgaaagtt
acagctggagactcttgtactctggaatgcacagtagatggcacaccagagcttactgct
agatggtttaaggatgggaatgaattgtctactgaccataaatataaaatcagtttcttc
aacaaagtatctgggcttaagatcctcaatgcaggactagaagatagtggagaatatact
tttgaggtgaaaaacagtgttggtaaaagcagctgcactgcttcagtgcaagtttcagat
cgtattataccaccttctttcacaagaaaactgaaagaaacatatggtcagctgggttct
tctgctgttctggagtgcaaagtttacgggtcaccgcccattcttgtttcctggtttcat
gatggacaggagattaccagtggagaaaagtatcaggctacccttacagacaatacttgt
tctctgaaagttaatgggcttcaggaatctgatacgggaacttattcatgtacagctact
aatgtagctggatctgatgaatgcagcacatttttgagtgttagagaaccaccatctttc
ctgaagaaacccgaaccattgaatgttctatcaggagcaaacatcacatttacaagtatc
gtaagaggctcccctccattgcaagttaaatggtttagaggtagcgttgagctagcacca
ggacacaaatgcaacattaccttgcaagactccattgcagaattggagctatttgatgta
cagccacttcaaactggagactacacctgccaggtctctaatgaggcagggaagatttct
tgcacaacacatctttttgtcaaagaaccagcaaagtttgtgatgaaggtgaatgattta
agtgtagagaaaggaaaaaatttaatcttggaatgcacatataccggtactccaccaatt
tcagtgacatggaagaaaaatggaataatattaaaacactctgaaaagtgtagcatcacc
actacagaaacttctgccatactggaaatccctaatagcaaactagaagatcaggggcag
tattcttgccatattgaaaatgactctggacaagataattgtcatggtgcaattacaata
ctagaaccaccttacttcgttacacctttggagccagtgcaggtgactgttggggattct
gcgtccttacagtgccaggttgctgggacaccagaaatgattgtgtcatggtacaaagga
gatacaaagttgagaggaacagctactgtgaaaatgcactttaagaaccaagttgccact
ctagtcttcagccaggtggacagcggtgacagtggggagtacatctgcaaagtagaaaac
actgttggggaggctacttcatcttctttgcttactgttcaagagcgtaaacttcctcct
tcttttacaagaaaattaagagatgttcatgaaactgttggcttaccggttacatttgat
tgcggcattgctggctcggaacctattgaagtatcttggtttaaagacaatgtacgtgtg
aaagaagactacaatgttcacacatccttcatagataatgtagcaactctgcagattttg
aagaccgacaagagccttatggggcaatatacctgcacagcgagcaatgctattggaact
gcttcttctagtggcaaacttgtccttacagaggggaagactcctccattctttgatacc
ccaattacacctgtggatggtattattggagaaagtgctgactttgagtgtcatgtttct
ggaacacagcctattagagtcacctgggcaaaagataaccaggaaattagaacaggagga
aactatcagatcagttatgtagaaaacacagcccatttgaccatcttgagagttgacagg
ggagactctggaaagtatacatgctacgctagcaatgaagttggaaaggattcttgtaca
gcacaactgaatgttaaagaacgaaaaactccacctacttttactaggaaactgtctgaa
gcagtagaagaaacagaagggaatgaacttaaacttgagggccgtgttgctggttctcaa
cctctcactgtttcttggtataaaaacaatcaggaagttcattcaagtcctcactgtgaa
atatcattcaaaaacaataccttgcttttgcatatcaagagcgtagggcaatcagatgct
ggtttatatacctgcaaggtgtccaatgaagcaggaagtgtgttgtgtacatcctctgtt
gttatcagagaaccaaaaaagcctccagtttttgaccagcctcttcagccagcagcaaca
gaggaaggcaataccctgcagctcagctgccatgtccgaggatcagagccaatccggatt
cagtggctgaaggcaggaagagaaataagagcttcagaaagatgcagcttcagctttgct
aatggagtagctcttctggaacttgctgcagttaccaaatctgattcaggagaatacgtg
tgcaaagcttcaaatgtggctggcactgacacttgcagatctaaagtgacagttaaagaa
aaagcagcagctttaccagcagctaagaaagcagacatggaaggaaaactttattttgta
tcagagcctcagagtatcaaagtcatggaaaagactgttgcaacatttattgcaaaagtt
gggggagacccaattccaaatgttaagtggatgaaggggaaatggaggcaactcaaccag
ggtggtcgtattataatccagcagagaggagatgaagccaaactggaaataaaggacaca
acaaaaacagattctggcttgtacaaatgtgtagcttttaaccaacatggtgaaattgag
aggagtgtcaacctgcaagttgaagaaaggaagcaagaagttgttgaagaggatgtcagg
ggaaaactgaaaagaattccaacaaaaaagaaggaagacgaagagcaaactattgatatc
ttggaacttctcaaaaatgttgatcccaaagaatacgagaaatatgctcgcatgtatgga
attacagatttccgaggcctcctgcaagcttttgagttactaaagcaaaccagagaagaa
gaaagccatagattggaaattgaactcacagaaaaggctcaaaaagaggaccaggagttt
gaagaacttgtagcatttattcagcaacgactcacccaaacagagcctattactctaatc
agagacattgaaaatcaaacagttttaacagatgaagatgctatctttgaatgtgagatt
aaaattaactatccagaaattaagctttcatggtacaagggaactcagaaactggactcc
agtgacaaatacgaaattaaaattgaaggtgatcgccacatactgaaaatcaggaactgc
caacttgaagatcaaggaaattacagaatagtgtgtggaccacacattgccagtgctaga
ctaactgtgattgagcctgcagttgaacggcatcttcatgacactactttcaaggaagga
aacacatgcacgctgtcttgtcaattttctatcccaaatgccaagtctcagtggtataga
aatgggaggccaattaagataggagggagatattcaacacaagtctccgacaaagtacac
aaactcatcatcaaggacgttagaacagaagaccagggacagtatacctgcaagcttgac
aatctagaaacatctgctgatctggccattgaagctgaaccaattcagttcacaaagagc
atacagaacattgtagttagcgaacaccaatctgctacctttgagtgtgaagtgtccttt
gatgatgcagttgtgacatggtataaaggtcccactgaactgagagaaagcccgaagtac
agcttcagaagtgaaggtcgttgtcattatatgactattcacaatgttactgcagaagat
gaaggtgtatattctgtaattgctcgtcttgaaccaaggggagaagcaagaagcactgca
gagctctatctggtaaccaaagaaatcaaactggagttgaagcctccagatgttcctgat
gccaaggtagcagttccacctcaaaaaccagctgaagaagctgcccccattcctattctt
ctgcccctcattccaccaccagaagagaaaaagccagcagaaaagaaagttccagtaaag
aaagtctcgaaaaaggtggttaaaaagggtgccaaggaaatcccaccacctgaagctcct
gaaatactgccagagaagcccaaagaggtcaaaataacatctatggcaaggagagaaggg
attcatgaagaaaaaatggaaatatatgaaaaacccaaagaagtttatgaagaatgggaa
gaagattatggagaagatcatgattattatttcaaggaagaaggctatgatgaagaagaa
gaggaatgggaagaaacttatgagaaaagagaggtggcttatgaagaaaaacaaatcatt
catgaggaagcggtggaagttcctaagaagcctgtgcctgagcgaaagcctccagcaatt
acagctgaaaagaaagaaaagaaagaagttacagttcataaagttgtcaagaaacctgtt
gatgaaaaagttgagattaccactcagagggttgcagaggaaaaactcaaacgggctgag
gttaccaagaaaatcccaccagcaaaacctacaccaatgatcgtcgaggaaaaagttatg
aaaaaggaagtaccaacagtagaaagatggactgtttcagaagaaaagatgtcagtttct
gtccacagagaagaagagtattcatatgtcacaggtatgttgccagaggagcccaaaaga
gctcccccagaggaaaaagttgctgttccaaaaagagaagcagctccaccacctaaagca
ccagaaatacctaagaaaccagtaccagaagaaaaattgcctcagattcctaaagtagaa
gaggctccacctgcaaaagtgcctgcagttcctaagaaacctgtccctaaagaaaaggta
cctcctgctgttcctaaaaaagttgaggctcctccagctaaagtacctgaagtgcagaag
agagcaacttttgaagaaagaatgcttattacagaagaaaaaatatctattgctgttcca
gaagaaatcccatcacctgaagaaccaatagttgaagaatggtctgaagaagaaacagag
gaagtatctgtttccattcacagagaggaggtttctgaagtgactgaagaagagtcttat
tacatagaagagaaggtaactgtgcctaaaagaaaggaagccccacctgctaaagtgcct
gagaagcctaggagagttgcccctgaaccagaaattccagctgctctgaaggaagctcca
gcagctaaagtgcctgaagttcataaaaaagtaactccaaaagagaaagtacctgtccct
gttcctaagaaggtggaggctccaccatcaagagaacgtccagaagaagtgcccactttt
gagatagctgttgaagaaccaccatcaaccaaagtgactcaagtgcacagaaaaattatc
acagaagaaaaggttgcggtcgctaaaaaagatgaggctccacccaaaagagcagtgccc
aagaagactgtgccagaagagaaagttccagttccggtttcacggaaagtggccgctcca
ccagctaaagtgccagaagagccaaagaaaatgatccgagaagaaagagtacccgttgct
gttccaaaaagaaaagtgtcaccaccactagaagaagaagaacactgggctatgtcagag
gaagtgtccgtttctcttcacacaaaggaggagatttcatacacagtgcctgatgtacca
gaaagggctatcattgaagaaagagtaccaatttctcctcctaaaaaaatgccaagacca
ccagccaaagtgcctgaagtacgcaagatggttgtccaaaaagaaaaggtgtatattgaa
gttcctcaggatgaggaggaagaagaaattccgcagtatgaagaagtaaccaaatatgag
aaggaagtaatccattatgaggaggaagtccaacattatgaagaagttagtcattatgag
gaagaagctcctcagtatgaagaagttcctcaatatgaagaggaagaagtcactcgtgaa
gaagaagaagctgcttattatgaagaggaagttcctcaatatgaggaggaggaggcagaa
attccccaatatgaagaggaggctccaccaccagttagagtgcctgaggtgcccaagaag
gctgttccagaggaaaaaatacctgtgctgaagaaaaaggaagttcctccagcaaaagtg
cctgaggtgccaaagaaacctgaacctgaaaagaaagtccaggtgccaaagaagaaggaa
gctcccccacctaaagttccagaagtgtcaaagaaacctgtgcaagaggagaaggttcca
attcttgtaaagaaaaagaaggatcttccaccagctaaagttcctgaagtaccaaagaaa
cctgtgccagaagaaaaggtacttgtcccagtacctaaaaaagtggaagaacctccatca
gctaaagtgcctgaagtgtccaagaaagttccagaaaagaaagaacctgtccctgtacat
aaaaagccagagccttcaccagccaaagtgccagaaataccaagacctgctcctgaagag
gcacctacttttgttcctgaagaagaggaagaagaggaagctattccagagataccagta
aaagtgccagaagtgcccaagaaagctgtaccagaagaaaaagtacatgttgcagttcct
aaagcaaagaaaattcctccagctaaagtgcctgaggcgccaaagaaagttgtgcctgaa
gaaaagattcctatttttattcctgagaaagaagaggaaactattccagagaaagccata
ccaacaaaagtgcctgagatgcctaagaaacctgttccagaagagaaggtacctattcct
aaaaaggtgccggttccaccagaaaaagtacccaaggtgcctatgaaagttgttcctgaa
aagaaggtacctgttgcccctcctgaaaaagtggaagttccagctgcaaaagtccctgag
gtgcgtaaaagagatgttgcagaagagaaagtaccagtcattgttcctaagcccgaagaa
ccacctccaagtaaagtgcctgaaatatccaagaaacccattcggaaagtccctgctccg
gctcctgctcctgttcctgcagcagagaaatatgaatatgcatatgaagagtatgagaaa
tatgagacgtacgaaagtatcgaagaatttgagggggttcaggaaagtgaagaaattgaa
gcatatgaggaacctgaagtacctgagagatacagagaaatccaggaacaagagtatgaa
ctggaggctgaagagaaggaagatatctatgagaagtatgaatttagggagaaagaagaa
atctatgagaaatatgaggaagcatatgaggaaacttatgaaatcccaccagctatagta
cccgaggtgcctaaaagacctctgccagaagaaaaagtacctgttcctgttccaaaaaaa
gaagctccgccagctaaagtgccagcactgccaaagaaacctgttccaaaggagaaagta
ctacctgctgttcctaaaaaggaagtggttccaccatctgaagttcccaagattgataag
agtgctgtacttgaagacaaagtacccatcttaattcctaaagaagatgaagctccttta
tatgaaggtacatcagtgatacatctaaccgagcaatgtttaattccagatatgggtata
tttaaatttatgttcaaacagttatttgtctgtatttgtctctgcatattaagcattctt
tctaatcttgtcttgtacgtaatattaaaatatgtaaaatatgctaatatctttaaagag
ccagaactttatgaagatcttccaacagaagagctccctgctattattcctattaagcca
aaagctccagcacctaaagcacctgcagtgacaaagaaaatagtctcacttaagaaaata
cctgctgctgtgcctaaagaagaagctcctccacctgaagtaccaaagaaacctgtccac
aaagaaaaaatacctccttctccaccaaaagaagaagcttcacatcgtaaagtacatgaa
gtttatgaggaaatatatgtagaagaagaaatttctactgttcatagaaaagaggaggct
tcgccacctggagtgcctgcagttgtgaaaattgctcctgaagtgcctattgctgtgcct
aaaaaaacagaacctactcctgtgtctagaaagccaggatcaccatctaaagtgcctgaa
gtgcccacaaaagttattgctgaagagaagcctgtccctctgtctaaaaagccagaagct
ccacccaccaaagtgccagatgtgcccaagaaaattccagaagagaaagtacccatcact
gtgccgaaaaaaccagaaccaacaccagccaaagagcctgaagtgcccaagaaaatagaa
gagaaaatcaaagttattgagcctaaaaagccagaagtaccaccagctaaagtgcctgag
gtaccaaagaaagtggtccaagaagaggtttcagttgaagtacctaagaaaccagagcct
ccaccagctaaagtgcctgaggtacccaagaaagtggttccagaagaaaaagtacatgtt
gaagttcctaaaaaaccagaacctccgcctcctaaagaacctgaggtgcccaagaagatt
gttccagagaagaaattaccggaacctgtggctgtacctgaaaaaccagagcctctacca
gagaaagcaccagaagtgacagcgagaactgtcccagaggagaaagtgactcttgaaaca
cctaaaaagccagaattcaaaaaaccagagcctcctccaaccaaagtgcttgaggccccc
aagaaagttgcctctgaggaggaagtacctgttgctcttcctaaaatacctgaacctcta
ccaagtgaagaatatgaaattgaaaaggaaagtgaagttgaagaaacagaagaaatttca
gtaacagaagtagaagaaactttacctgttgaagcaccagaacctgaaaagaaaattcct
gaaaagcgaaagccagcagttcctgcaccagtagaagatattaaactggcaaaagaacta
cttaaagctcctgaaacaaggaagaaagttgtgacagcaaaacctgttgaggctccacaa
ttggaacccccacctgctaaagttcctggacttgtaaagaaacctcgtagaataattcct
gaagttactcctccaccgaaagaagaagttgttttgaaaagagttcttagaaagaaacca
gaagaggaagaacctaaaccagagaaagaacctaaacctgaagttaaaccagtacctaca
ccagtagaaaaaattaagaaacctgaagtctcagaagttcccaagaagaaacctgagata
cctgtcattaaaaaggaggagaaacatgttcctgaaccaccaaaagaacctaagcaggca
gctatctcagttcctgggcctgaacctaaacctgccgtagctttaaaatctccaaagcca
gcagcagaaccagcaccagctattactactgcaccagtgacaactcctgttgttggaaag
aaagcagaggccaagccaacaaaagaagaaactccaaagggtatcagcccagtcaaagcc
aagaagacaccttcaccagcagatgcagaaaggaggaaactcaggccaggtagcggtggt
gaaaaacctcctgaagagcctccattcacttatcaactcaaggctgtgccactgaagttt
gtcaaggagatgaaagatatagtgctgaaagaagcagaatctgttgggtcttctgcaatc
tttgaagtccttatttcaccatccactgcaattaccagctggatgaaggatggaagtaac
atccgagagagcccaaagcacaagtttattgctgatggcaaagacaggaaactgcatatc
attgatgtccagctgtcagatgctggtgaatatacttgtgtattacgactagggaacaaa
gagaagacctctactgccaaactcattgttgaagaactcccggtacgatttgtgaaaaca
cttgaagaagaagtcactgtggttaaaggccagccactgtacttgacttgtgagcttaat
aaagaaagaagtgtggtctggagaagggatgggaagatcatcaaagacaagcctgggaaa
tttgctctgggtattattggtttgtcacattccctcaccatcactgattcagatgattct
gatgctggcacctacactgttaccgtggaagactctgagctctcatgctcatcttgtgtt
aaggtagtagaagtgataagagactggctagtaaaacctataagagaccagcatgtaaag
ccaaaaggaacagctacttttacctgtgacattgtcaaggatacaccaaacattaaatgg
tttaaaggcgatgaggaaattcctgctgaaccaactgacaagacagaaatcttgaaagaa
ggaaataaaattttcctgaaaattaagaatgctggccctgctgatattggagaatattca
gtagaaattgaaggtcgcagatacccagctaaactgacccttggggaacgtgaagttgaa
cttctgaagccattagaggatgttacagtttacgagaaagaaacagcaaactttgataca
gaaatatcggaagaagatattcctggtgaatggaagctgaaaggtgaaatcctgcgaccc
tcacctacatgtgaaatcaaagctgaaggaggaaaacgcttcctaactttgcacaaagtc
aagttagagcaagctggtgaagtcctttaccaagcgcttaatgcagttactacagctatc
ctgacggtgaaagaaattgaactggactttgctgttcccctaaaagatgtcactgtccct
gagaaacgccaagcaagatttgaatgtgtccttaccagagaagccaatgttatatggtct
aagggcactgatatactgaagattggagaaaagtttgacatcattgcagatggaaagaaa
catattcttgtaatcaatgattctcagtttgatgacgaaggagaatacactgctgaagtt
gaaggcaagaagagcaccgcaagactgtttgttgaaggtgtgaggctgaagttcatctca
cctctacaggatcaaacagtgaaagaaggagaaacagctcactttcagtttgagctttct
catgaagacatgctagtgaaatggtacaaaaatgataagagactccatacaagcagaacc
gtttttattacttcagaaggaaaagttcataaactagaaatgagagaagtaacacttgat
gatatctctgaaatcaaagctgtagttaaggatatgaacacacaagcaaacctcaaagtc
ttagaggctgatccatacttcactgtgagattacaagactacagtgctctggagaaagat
gatgttactctgcagtgtgagcttagcaaagatgtcccagtaaaatggtacaaagatggt
gaagaactagttgcttcaagcagaatttccataaaaacagatggcttgcgccgtatccta
acaatcaagaaggctgcagagggtgacaagggtgtttatgagtgtagctgtggaacggac
aagacaaattgtaacattggcattgagcctcgcttaattaaagtggagcgcccgctgtat
ggagtggaagtatttgttggtgaaacagcacgttttgaaattgagatttctgagccggat
gtccatcccatatggaaactgaagggagagaccctaacaccttcacctgagtgtgaaatc
cttgaagatgggaagaagcatgttctcatccttcataactgcagactggatatgactgga
gaagtgtctttccaagctgctaatgctaaaagtgctgccaatctgaaagtgaaagaattg
cctctcatcttcattactccactaagtgatgtgaaggtctttgagaaggatgaagccaag
tttgaatgtgaagtgtccagagagcccaagaccttccgctggttaaaaggaacacaagag
atcacttctgatgaaagatttgaaataatttcggatgggacaaagcatgctctgattatt
aaatctgttgcatttgatgatgaggctaaatatatgtttgaagctgaagataaaagaaca
agtgccaaactaattattgaaggtattcgcctgaaattcattactcctctcaaggatgta
acaaaaaaggagcgagaaactgcagtgttcacagtagaactctctcatgaaaatatcccc
gttgtctggttcaagaatgaccaacgattacataccactaaagtggtttcaatgacagat
gatggcaaatttcatacactcacaatcaaagatcttactattgatgatacttctcagatt
agagtggaagctatgggcaaatcctcagaagctaaactcactgttctggagggagaccct
tacttcactgggaagcttcaggattacacagctgtagagaaagatgaagtgattttacaa
tgtgaaatcagcaaagcagatgccccagtgaaatggatgaaggatggcaaaccaattact
ccatcaaagaatgttgttattaaggctgatggtaaaaagagaatacttatactgaagaaa
gctttgaagaaagacattggacaatatacttgtgattgtggtaccgatcaaacctctgct
aacctcaatattgaagacagagatattgaaattatccgtccactatacagtgtggaggtg
attgagacagagactgcccgttttgatattgaaatatctgaggaaggtgtccatggcaat
tggaagctaaaaggagaacccctgactgaatcacctgactgtgaaatcaaggaggaaggc
aaaaagcactttcttaccttgtacaatgtacgtttagatcaagctggtggagtagatttc
caagcagcaaatgccaaatctggtgctcaccttcgagtgaaacctcgagtaataggcttg
ctgagacctctcaaggatgtaacagtgacagctggggaatctgcaacttttgattgtgaa
ctctcttacgagggaattccagtagagtggtacctgcaaggaaagaaactggagcccagt
gataaggttgtcacacgtgctgaagggagagctcacacacttattcttagagatgtcaag
ttaacagatgctggagaagtgtcactgactgcaaaagatttcagaactcaggcaaatctt
tttgtgaaagaacccccagttgaattcactaaaccacttgaggatcagactgttgaagag
gaggccactgcaatactggaatgtgaagtttcaagggaaaatgcaaaagtaaaatggttt
aaaaatggagaagaagttcataaaacaaagaagtatgatatcatttctgaaggcagagtc
agaaaactcgttatccatggctgcacgctggatgatgcaaaaacatatacttgtgatgcc
aaagattttaagacatcatgttttctcaatgtcgaacctcttcgtgttgagttcctgagg
ccactaactgaccttgaagttaaagaaaaagagtctgctcggtttgaatgtgaaatttct
cgcccaggtgtcaaggtgaagtggtttaaggatggcattgaaattagaaaaggcaagaag
tatgatataatttccaaaggggcagaacgcattcttgttattagtaaatgtctctttgat
gatgaagctgaatatgcctgtgaagcaaaaacagctagaacttctggccttcttacagtg
atagaggaagaagctgttttcacaaaaaatcttcatgatcttgaagtaaatgaaaatgag
actgtaaggttgatctgtgaaatctcaaagcctaatgctgaagttacttggtttaaagga
gatgaggaggtgcctgatggtggtagatttgaatacatttctgatggccgaaagagaatt
cttgtcatacgtaatgctcatcctgaggatgctggcaaatatacttgcaaactaccaagc
tctagtacaacaggaaaacttactgtacatgaacttgctgcagaatttcttaccagacca
caaaatcttgaagttcttgaaggagacaaagctgaatttgcctgttcagtatccaaagag
gcaataacagtacaatggctgtggggtgacacagtcctggaacccagtgataagtatgac
atcatttcagatggcaaaaagaggacacttgtggttaaagactctgttataggagatgca
ggaaagtactctgtcatggttggtgaagctaaagctacagcacgtctgacagtgattgaa
aaactcaggattgtaactccccttaaggaccaagaagttaatgagggtcaagaaattatc
ttcaactgtgaagtaaataaagagggtgccaaagagaagtggtacaaaaatggcgaggca
atatttgatagtgcaaaatatattattgtccagaaggatttagtttatactctccgaatc
agggatacacagttgaaagatcaagctacctacagtatctcactgtcaaaccacagaggg
gaacatgccgagagctctgctgccttaacagtactagaggaggaccttagaattgttgaa
cctcttgaagacattgagaccatggaaaagaaaaccgtcacattctggtgcaaagtcaat
cgtcttaatgcaactctcaaatggacaaagaatggtgaagagatcacctttgacaagcgt
attctgtataaaattgataaatacaaacactcactcatcataaaagactgtggctttaaa
gatgaaggtgaatacactgtaactgctggacaagacaaatctgttgcagaacttctcatc
acagaagcaccagcagatttcattgaacatctccaggaccagactgtcactgaatttgat
gatgctgtctttacctgccagctgtccaaggagaaagctagtgtaaaatggtatagaaat
ggcagagaaatcaaagaaggcaaaaaatatcagtttgaaaaggatggaaatcttcacaga
ttaatcataaaagactgtagactagatgacgaatgtgaatattcctgtggagtggatgac
agaaaatctagggcaagactttttgttgaagaaatccctgtggagattattcgaccaccg
caagatgtttatgaagctcctggtgcagatgtcatcttcatggctgaactgaacaaagat
ggtgtggaagtcaagtggctgagaaacaacatgattatcatccaaggagacaaacatcaa
atgatgagtgaaggaaaagtccataggctgcaggtgtgcgagataaagcctcgtgaccaa
ggggaatacagatttattgctaaagataaggaagcaagagctaaacttgaattagctgct
gcacctagaatcaagactggtgatcaaaacctggtggttgatgttgggaagcctttaact
atgactgttccatatgatgcctacccaagagcagaagctgaatggttgaaaggggaggaa
agtctgccaacaacaactgttgatacaacaaatgactgtactaccttcaaaatttatgaa
gcaaagaaatcggataagggaaggtacaaggttgtacttcgaaacaaacatggccaggca
gaagctttcatcaatgtagaggtcattgatgttccagggccagttagaaacttggaagtc
actgaaacttatgatggtgaagttggccttgcctggcaagaaccagaaagtgatggtgga
agtaaaatcattggctacgttgttgaaaggcgtgatatcaagcgtaagacttggattgtg
gccactgatcatgctgaaaattgtgaatacactgttactggacttcagaaaggaggagtt
gagtacctcttccgtgtaagcgcacggaaccgagtgggtactggtgagccaatagaaaca
gagagacctgtggaagctaaaagcaaatttgacgttcctggtcctcctcaaaatgtagaa
gttactgatgtgaataggtttggtgctacccttacctgggaagttcctgagtatgatgga
ggatctccaattactggctatgttattgaactgcgtaacagagcttccatcaaatgggag
ccaactatgaccactggagctgatgaactgtcagctgtcctgactgatgttgtggaaaat
gaagaatatttcttcagagttagagctcaaaatatagttggagttggcaaaccaagtcat
cctacacgtgcagtgaagattatggacccagttgagaggccaagtcctcccattaacctt
gatcattcagatcaaacaaaaacatcagtgcagctcacatgggaacctcctctccaagat
ggaggaagtccaatcttaggatatattattgaaaggaaggaagaaggaacagacaaatgg
atccgctgtaacccaaaactagtaccagcgcttacttttaaggtaactggattgaaagca
gggtctagttattactacagagtctcagcagaaaatgcagctggggtgtctgacccagct
gaggctatcggaccattaactgcagatgatccttttgttggacctacaatggacctaagt
gcttttaaagatggactagaagttattgttccagaaccaataaagatccgtgttcctatc
accggctatcctattccaactgccacatggtcttttggtgaccgagtcttagaagaaggt
gatcgtgtaacaatgaagaccactgccacctttgcagaacttgtaattactccaagtgaa
cgtccagacaagggaatttatactttaacattagaaaaccctgtatcatctgtttcagga
gaaatcaatgttaatgtcattgctcgcccaggtgctccaaaagaacttaaagttgtggat
gtaagcaggagtacagtacagctgtcatgggaacctccagaagatgatggtggaagtcca
gttattgactatataattgaaaaacgtgaagtaagccggaaaacatggatcaaggttatg
gatcatgtcatggaccaagagttctctgtacctgacctcatccaaggaaaagaatattta
tttagagtttgtgcatgcaataagtgtggcccaggagagcctgcatatattgatgaacct
ataaatatgtcagcaccagcaacggtgcccgatccacctgagaatgttaaatggagaaat
ccaacatcaaaaggaatcttcctaacatgggaacctcccaaatatgatggtggtgctcga
atcaagggctatctggtagaaaaatcacaacgtggcacagataagtgggagatatgtggg
gagcctgttattgaaacaaaaatggaagtaacaaaacttaaggaaggagagtggtacgca
tatcgggttaaggctttgaacagaataggagcaagcaagccaagcaagccaacagatgat
attcaggccattgatgcgaaagaggctccagaaattttcttagatgtgaaactgctcgct
ggactcactgtgaaagctggaactaaaattgagctgccagccaaaataactggaaagcct
gagccccagattacttggaccaaggctgaaaaaatactgagacctgatgatagaatcact
attgaaacgaaacctgatcattctacagtcactattacagacagcaagaggagtgacagt
ggaacctatattatagaagccgtaaattccagtggacgcgctacagctgttgttgaagtt
aatgttctcgataaacctggtccaccagctgcatttgatgtatcagaaatcacgaatgaa
tcttgccttctgacatggaatcctccccgagatgatggaggttctaaaattacaaactat
gtccttgagaaaagagctacagacagtgaaatatggcataaattgtcatcaactatcaag
gacacttcattcagagctaccaatttaattcctcataaggaatatgtgttccgagtcagt
gctgagaacatgtatggtattggggagccagcacagtgtaaccccatcattgcaaaatat
tcctttgatccaccaggccctccaacaggtctcaaacctatagaggttaccaaagattca
gtgaccctaacatggaatgaaccagatgaggatggtggcagccccattactggctactgg
gttgagagatacgatcctgagcaggataaatggataaaatgcaataaaatgccagtgaaa
gatacaacattcaaagttaaaggtcttacaaataagaagaaatacaagttccgtgtgttg
gcagagaatcttgcaggacctggaaaaccaagcaaggaaacagagccaatcttagtgaaa
gacccaattgatccaccatggccccctggaaaaccaacagtgaaggatgttggcaaaacg
tcattattcctgaactggacaaagccagaacatgatggaggggcaaagattgaatcttac
gtcattgaactgttaaagactggaacagatgagtgggtgagagtggctgaaggagttccc
acaactgaacacttcctcaaagggcttatggagaaacaagaatattcattccgtgtaaga
gctgtgaacaaggttggagagagtgagcctagtgaacccagtgaccctgtgctgtgcaag
gagaggctgtatcctccttctcctcctcggtggcttgaggttattaatattactaaaaac
acagcagatcttaaatggacagtgccagaaaaggatgggggctccccaattaccaactac
attgttgaaaagagagacgtaaggagaaaaggctggcagactgtagatacaacagtgaaa
gataccaagtacacagtgagcccgctgactgaaggctcattgtatgtcttccgtgtggct
gctgaaaatgccattgggcagagtgattactgtgaaattgaagattcagtgcttgctaaa
gacactttcacaacccctgggcctccatatgctcttacagtagttgaagtgacaaaaggt
catgttgatttgaaatgggaaccacctaagaatgatggtggcagaccaattcaaagatat
gttattgaaaagaaggaaaaactagccacccgctgggtaaaagctggcaagacagctggt
ccagattgcaatttcagagtgactgatgtcatcgaaggcatagatgtacagttccaggtt
cgtgcagaaaatgaagctggctgtggtcatcccagtgaaccaactgatctcattcatatt
gaagatccaacaagccctccttcacctcctcaggatttacatgtcacggatgcaggtcga
aatcatatttgcattgcatggaagccaccagagaagaatggtggaagtcctattattggg
tacaatgttgagttgtgtgaagcaggaacagaaaaatggatgcgaatcaattctcgtcca
ataaaagatctaaaatgcaaagtggaggaaggtgttgttccagacaaggaatatgtgctg
agagtcagagcagtcaacgctgttggagccagtgagccatcagacatctcagaaaaagtt
gttaccaaggacccggactgtaatccaaccattgatctaaaaactcatgatattgttgtt
gttaagggacagaaattaagtatccctgtacccttcagagctgttccatccccaacaatc
acatggcacaaagatggcaaagagttgaaagctggtgacagaacaacgatgaagagtgac
tatacttctgcattgcttgaagtcatagagagtgttcatgctgatgctggtgtttataca
attacactggagaacaaactggcatcaacaactggctctgtcaacgtcaaagtcataggt
ccacctggacagtgtaaagacattaaggcaagcgaagtaactaagaattcttgtaaggta
acgtgggaacctccagactttgatggtggtactcctattctgcattatgttctggaacgc
agagaagctggtcgtagaacatatatcccagtaatgtctggtgaaaataaactctcatgg
caagtcaaagatcttattccaaacagtgaatattacttccgtgttaaagctgtcaataaa
attggaggaggtgaatatcttgaactaagaaacccaattattgcagaagatccaaaacag
cctccggatcctcctgttgaccttgaggtccataatccaacatcaaagtcagtaacgctt
acatggaaaccaccactgtttgacggcggaagcaagattatgggctacataatagaaaag
cttgctaagggcaaggagagatgggaaagatgcaatgaatatctggtacctctattaacc
tatccagtgaaaggtcttgaggaagggaaggaataccaatttcgtgttcgtgctgagaat
gctgctggtattagtgagccttctcggattactccttttgtgaaagctgtggatcctatt
gaggctcccaaagtcttccttgctgcaaacctgcagtctggtcttgaggtgaagaaaggt
gatgagatcatacttgaggcacatatttcaggatcaccttatccatctatcacttggctg
aggaatgatgaagttatcagaccagaggaaatcaaaaagagagtaacaacatatactagg
aagaagaagggtgtaactgaagaagaggaaccttttcagctttcactgccagaacgtaca
agtattgacaaccataaagaaggagagtctgtactatcaattcgtgactccatcagagct
gaccatggcacatttacaattaaagtggaaaatgatcatggtgttgcaaaagcatcctgt
gaagttaatgtgttagatactcctgggcctccagtcaactttgtatttgaagatatgagg
aaaaattctgtcatttgcaaatgggagcctccccttgatgatggtggaagtgaaatcctg
aactatgtactggaaaagaaagacaacacaaaagctgaaatgggctgggttactgtcagt
tcaacactcaggcattgtaaattccatgtaacaaaactgatcgaagagaaagaatatctc
ttccgtgtatttgctgaaaatagagttggagcagggccaccatgtgtttcaaaaccaatg
acagcaaaagatcctttctctccaccagatccacctaataagcctgatgtggaagatgtt
accagcaacagtatgttggttaaatggaatgaaccaaaagacaatggcagcccaatcata
ggatattggattgaaaaacgtgaaattaatagcactcattgggctcgagtcaacaggaac
cttgtgaatgctctggaactaaaagttgaaggactattggaaggattaacctatatcttc
agagtttgtgctgaaaatgcagctggtcctggtaaatttagtccaccatcagatccaaaa
actgcacaagacccaataatgccacctggtccacccattccaagggttgctgatacaacc
tcagtttctattgagttagaatgggaacctcctatgtataatggtggtggagatatcact
ggttaccatgtatacaaacaactaatgggaacaaaagagtggtcacgttgcacagagaaa
cccattaagatccgacagtatactgtaaaagaagtcagagaaggtgcggactataaactt
cgtgttactgcacttaatgcagctggtgaaggaccacctggtgaaactgaacctgtaacc
gttgcagaaccccaagagcctcctaccgttgagctggacgtttctgtcaaagcaggcatt
cagatcatggctgggcaaacaattaaaattcctgctactgtgacagggcgtcctgctccc
accattgtatggactgtggaggagggtgaattggacaaagatagagttgttattgaaaat
gttggcacaaaatcagaattaaccattaagaatgcattgagaaaagaccatggaagatat
gtaattactgcaacaaacagtagtggttccaaatcagcgggaaccagagtagaagtattt
gatgttcctggaccagtacttgacctaaagcctgtggtcacaaacagaaagatgtgcttg
cttaactggtctgatcctgaagatgatggaggcagtgatatcataggctttattgttgaa
cggaaagatgccaaaatgcatacatggagactagctatcgacacagaaagatctaaatgt
gatattacaggtttagttgaagggcaggaatataaatttcgtgtcagtgccaagaacaag
tttggtaccggtccagctgttgaaataggaccaattcttgcagttgatccattaggtcct
ccaacagcacctgagagattcatgtacacagagaggacaaagtcaaccattacacttgat
tggaagcctccacgtagtgatggcggtagtcctatcttaggatacattgtcgagaagagg
aggcatgattcaaaagattatgaaagagtgaacccaaggctctgtccaaccacgtctctt
ctcgttgaaaaacttgatgaactccatatgtatgaattccgtgtcaaagctgttaatgag
attggagagagtgaaccgtcattgcccctcaatgtagttatacaggatgatgaagtacct
ccaactgtaacattacgcttagctgtgagaggagatactatcaaagtgaaggcaggcgag
ccagttaatattcctgctgatgtgactggactgccaatgccgaagattgaatgggacaag
aatgaagttttaattgaccaaacatccagtgcacttaagataacaaaggaagaagtatca
agaagtgaggcaaaaactgaacttaccctgcctgcagccatgagagatgataaaggcact
tacactgtgagagcttccaatcgtcttggcactgcatttcgcaatgtgcatgttgaagta
tatgatcgtccttctccaccaagaaaccttgctgtttctgatattaaagcagaatcgtgc
tatttaacatgggatgcacctcttgataatggtggtagtgaaattacccattacattatt
gagaaacgtgatgctagtaggaagaagtcagagtgggaagaagtctccaacagtgctgta
gacagaagatatggggtgtggaatcttgcaacaaatgaaaaataccaatttagagtccga
gctgtaaacaaatatggaataagtgatgaatgcctctcagaaaaagttgttattaaggat
ccctatggccttcctggacctcctggaaagcccaaaatcttagatcacactaggtcatca
atgctggtggcatgggagcctcctttggacaacggtggcagcccaataactggctattgg
ttggagaagagagaggtgggaggtgtctactggtcacgtgttaatagggctccagtaacg
aaaccatcagtaaaaggtttacagtacaatgtgcttcgcttggctgaaggtgttgaatat
caattcagagttatggctgaaaatctggctggaattggcccacccagtgaaccatcagat
cctgctttagcagcagatcccatatttgtgcctggcccaccatcttgtccagagatcaaa
gacaagaccaaatcatctgtatctcttgcatggaagcctccacaaaaggatggtggtagc
ccaataaaaggatatattgttgaaatgcaagatgaaggtagtactgactggaaaaaggtg
aatgaaggagacaaactctttcccacttgtgaatgtgttattcccaatttgaaagagctc
agaaaataccgattcagggtgaaagctgtaaatgctgctggagaatcagaaccaagtcct
gcaacatctgacatacctatccaagatattttagaggaaccagaaatcttccttgatatt
aaagcacaagattttctctcttgtcgtgctggcacaacaattaaaatcccagctgttatc
aaaggtcgtccagttccaaaatcattttgggaatttgaaggaaaagcaaagacaacagca
aaggagggaggtcataatgtacctgaagaagctcaggtggaagcaactgatacacgttca
gtgataatcatccctgagtgcaacagaagtcattcaggacgatacagtataacagcaaaa
aacaaagcaggacaaaaaacagcacatatcagagtcaacgttcttgatgtcccaggtcca
ccaaaagacctaaaagtaagtgatatcacaagaggtagttgcaaactttcatggaagata
ccagatgatgatggcggagatagaatcagaggatatgttattgaaaaaagaactatcgat
gggaaagcctggacgaaagtcaatgcaaactgtggaagcacttcctttgtggtacctgat
ctcatatctggtcaagagtatttcttccgggtacgtgcagaaaaccgttttggtgttggc
cctcctgcagaaactatccaacggaccacagccagggatccaatccatcctcctgatcca
cctattaaattgaagattggccttgtaaccaagaacacagtgagcttgacatggaaacct
ccgaagaatgatggcggagctcctgttactcattataatgttgaatgtctccgctgggat
cgtactggagaagtgaaagagacttggaaacagtgcaacagacgtgatgtggaggaaaca
aagtttactgttgaggatcttatagaaggtggtgaatatgaattcagagtcaaggctgta
aatatagcaggtcctagcaggccttcagctactgttggtccacttgttgtcaaagaccaa
acgtgcccaccatctattgaactcaaagaatttatggaggttgaagaaggaacagatgtt
aacattgtggccaagataaagggcatacccttcccagcactaacttgggaaaaagcttct
ccaaagaaaccagatgacaaaaaaccagtgtcttatgaccaacatgtcaacaagattgtt
ggtgaagattcttgcactttattgattcaacagtctcgcagaagtgatacaggcttatat
actataacagctgtaaataatttaggaactgcttcaaaggagatgagactaaatgttctg
ggccgtcctggacctccagtgggcccaattaagtttgaatccattttggctgacaaaatg
acaatatcatggcttcctccgttagatgatggtggttctaagattacaaactatgttatt
gagaaaaaagaagcaaataggaggacatgggtaccagttacaaatgagcccaaggaatgc
ttattcacgattcccaagttgatggaaggccatgagtatgtgttccgcattatggcacaa
aataagtatggtattggagaacctttggacagtgaaccagaaacagcaagaaaccttttc
actcctccaacacttgaccttgacttcagagacaaacttattgttcgggttggtgaagct
ttcagcctgactggacgttactcaggaaagcctacaccaaagattacttggctgagggat
gatattgttttgaaagaagataaccgtacaaagattaagacaactcctacgacactttgt
ctgggaatactaaaatctgtccgtgaagattcaggcaaatattgtgttactgtagagaac
agcacaggatcaagaaaagggttttgtcaagttacagttgttgatcgcccatcacctcca
gtgggtccagttatatttgatgaagttcataaagatcatatgatagtttcctggaaacct
ccactcgatgatggaggcagtgaaattacaaactacattattgagaagaaggatgcacac
agagacatatggatgccagttacatctgctacagttaagacaacatgcaaaattcctaag
ctgcttgaaggaagagaatatcaaattcgaatttatgctgaaaatctctatggcataagt
gatcctctcatctctgatgagatgaaagccaaggaccgtttcagtgttcctgatgcacct
gaacaaccagttattaaggacgttacaaaagactctgcagtagtagtttggaacaaacca
tatgatggaggcaagccaataacaaactacattgtggaaaagaaggaaacaatggctact
agatgggtcagagttaccaaagacccaattttcccaagtactcagttcaaagtacctgac
ctccttgaaggctgccagtatgaattccgtgtttcagctgaaaatgaaattggtgttggt
aatcctagtccaccatcaaagccaatttttgctagagatccaattgtaaaaccaagtcca
cctgttaatccggaagcagtagataaaactaagaattctgttgacctgacttggcaacca
cctcgccatgatggtaatggaaagataattggctaccttgttgaatatcagaaggttgga
gatgaagaatggaaaaaggccaatcttacaccagattcttgtcctgagacaaaatataaa
gtcactggacttactgagggtttgacctataagttcagggtcatggcagtcaatgcagca
ggtgaatctgaaccagcctatgttcctgatccagtagaagtaaaggacagacttgaacct
cctgagctgatacttgatgctaatatggcccgggaacagcatgtaagagcaggagataca
ctgagacttagtgctgttattaaaggtgttccatttccaaaagtttcttggaagaaagaa
gataaggaagtctcacccaaagctgatattgaagttacaggtgttggcagtaagcttgaa
attcgtaacactgcccatgaagatggtggaatttactccctgacagttgaaaatccagct
ggttcaaagactgtttcagtgaaagttcttgtcttagataaacctggtccacctagaaat
ctgcaagtcagtgatgttagaagtgattcttgctatctgacatggaaggaaccagaagat
gatggtggttctgttattaccaactatgtggtggaaaggaaagatgtagcttctccacag
tgggtatctgtctcatcgacctccaagaaacgcagtcacatggctaaatatctcatggaa
ggcactcagtatcttttccgagttgcagctgagaatatgtttggtagaggaccatatgtg
gaaacactcaagccaattaaagctgtagatccattgcatcctcctggaccaccgaagaat
ctgcatcacgtagatgttgacaagactgaagtttcccttgtttggaatcgaccagatcgt
gatggcggtgctgagataactggatatttggtagaatatcaggaagatggtgcagatgag
tggacaaagttccaaacggtcccaatgctagactgtgttgttacaggcctacaaaaagga
aaaatatacaaattccgtgtgaaagctcaaaatattgtgggtctcagccttccagataca
acgataccaatagaatgtcaagaaaaactagtacctccatctgtagaactagatgtgaag
ttaattgaaggtcttgttgttaaagctggtaccacagtgagacttcctgcaattatgaga
ggtgtgccagttcccactgcaaaatgggttactgatgacactgaaattaagacggaaggc
agacacaagatagagactgacaattattcaactgtacttaccatcaaagactgtgtaaga
aaagatacgggagaatatctactcacagtatctaatgcagctggccacaaaactgttgct
ctacatcttacagttttggatgttcctggcccaccgactggtcctattaatattcttgaa
ataacaccagaacatatggttatttcttggcgtcctcctaaagatgatggtgggagtcct
ataataaactatattgttgagaagcgtcagtcaaagaaagagacttggggagtagttagc
tctggaacgagtcacacaaaaattaagattccacgactgcagaaaggctgtgaatatatt
ttccgtgttcgggcagaaaataagataggcattggtgcgcctcttgattcagaaccaaca
gttgctaaacatatgtttgatccaccatccccacctggtaaaccagtagtgtttgatatt
acagaaaatgctgcaacagtgtcttggaccctaccaatgtcagatggtggaactccaata
actggttatatacttgagcgtcgagaagcgtctggtaaatgggtgcgtgtcaataaggca
ccgatacttgatatgaaatacagagtcactggtctcttcgaaggcaacacatatgaattc
agagtttttgcagaaaacatggtgggcttaagcaagccatctccaagctctgatccaata
aaagcatcacgtcctatcactcctcctggaccacccattaatccaaaattaaaagataaa
accaaagaaacagctgatctagtttggacaaaacccctcaaagatggtggcagcccaatt
ctgggatatattgtggaatgccagaaaactggaactacacagtggaacaggattaataaa
gatgatctcatcagacaatgtgcctttagagtacctgggttaatagaaggaaatgaatat
aaattccgaataaaagctgtcaacattgtaggagagggagagccaagagaactggcagaa
actgtacttgcaaaggatattctttctcctccagaagtaagcttagatgtgacttgtcga
gacttaattactgtccgagtaggccaaacaatccatattactggcaaagtaaaaggtagg
ccagatcctgacataacatggtctaaggatggcaaagttttggtacaggaaaaacgcatt
gaaatagtccatgatctacctaatgttggactgcaagtaaaagaagccaaaagatctgat
catggcaagtatataatagcagctaagaacagctgtggacatgctcaaggttttgccatt
gtgaatgtacttgacagaccgggaccatgtcagaaccttaaaataagctatgtcacaaaa
gattcttgtatgattgcttgggagagtccagtggataatggtggctcagaaatcacaaat
tatattgtagagtatcgtcaaccaaatcagagaggatggtcaattgtgtcctctgatgtc
actaaacggttagtaaaggcaaatcttatagagaatcgtgaatacttctttagagtttgt
gcagaaaacaaaataggtccaggtccttgcattgagaccaaaactcccatccttgccata
aatcctattgacaagcctggagagccggaaaatcttcacattgcagagaaaggaaaaaca
tttgtattcctgaaatggagaagaccagattatgatggtggaagcccaaatttaagttat
catgtggagagaaaactgaaagattcagatgaatgggaaagggttcacaaaggcagcatt
aaggaaacacactacatggttgataaatgtgttgaaaataagatttaccaattcagagtt
caaaccaagaatgaggcaggtgaaagtgactgggtaaaaactgctgaagttgttgtgaag
gaagatctgcagaaaccagtgctggacttgaagttaagtggggtactaacagtgaaagct
ggtgacacaattagaattgaggctggagtcagaggaaaaccacaacctgaagttgcatgg
acaaaagacaaagatgcaacggatcttacaaggtctccaagagtcagtattgaaacaaca
tctgacacgtcaaagtttgttctcacaaaatcaaggcgtagtgatggtgggaaatatgtg
attactgcgactaacacagctggtagttttgtagcatatgctactgttattgttttggat
aaaccaggtcctgtaagaaacttgaaagtcactgacatttcaagtgacagatgtactgtt
acctgggaacctccagaggatgatggcggttgtgaaatacaaaactacatcctagaaaaa
tgtgaaagcaagcgtatggtttggtctacatactcttcttctgtcctaacaaactatgca
aatgtaacacgcctcattgagggtaatgaatatatattcagagttcgcgcagagaataaa
atgggcattggtccaccaacagaaacacacccaattatcgcaaaaactaaatttgataga
cctggacgccctgaccctccagaggtaacaagagtaagcaaagaagagatgactgtcgtt
tggaatccaccagaatacgatggtggcaagtcaattacaggatacatcttagagaagaaa
gagaaacgatcattaagatgggttccagttactaagactgctattcctgagagacgcaag
aaggttactaatctcatccctggtcatgaatatcagttccgtgtcagtgctgaaaatgaa
gttggacttggagaaccaagcttgccatcaagaccagtagtagcaaaagacccaatagaa
ccacctggtcctcccaccaacttgagggtggttgatagtacaaagagttcaataaccctt
ggctggggaaaaccagtgtatgatggtggtgctccaattattggatatgttgtggaaatc
agaccaaaagtggaaggtgctgatcctgaagcagggtggaaacgatgcaatgttgctgct
caagttattcatacagaatttacagccactagtctggatgagaaacaattatatgagttc
agagtttctgcccaaaatcaggttggccttggccggccagcagaactgaaagaagctgtg
tctcccaaagaaatacttgaacctcctgagattgaattggatgcaagcatgagaaagtta
gtcacagtaagagcaggatgtcctatcagactttttgccattattagaggtcgcccagca
ccaaaagtcacctggagaagaatgggtattgataacgtcatcagaaaaggacaagtcgat
ctggttgacactatggccttctgtgtcatccctgattcaacacgtgatgactcaggaaaa
tattcattgacactcgtcaatgtagctggagaaaaggctgtgtttgtgaacgttagagtt
ctggatactcctggacctgtgtctgacttcagagtttcagatgtcaccaagatgtcatgt
catctctcatgggcacctccagagaatgatggcggtagcccagtgactcattacatcctg
cagaaacgtgaggctgacaggaagacttggggaacagtcactgcagaactaaagaaaact
agtttccaaatagctaatcttgtacctggaaatgaatattacttcagagtaacagcagta
aatgaatatggatcaggtgttccaagtgacataccaaaaccagtcctagcaacagatccc
ttaagtgaacctgatccaccaagaaaacttgaagttactgaaattacgaagaacagtgct
actttaggctggctgccaccactgcgtgatggaggctcaaaagttgatgggtatattgtt
agttacaaagaagatgaccaaccaggagatcgttggacagaatattcagtagtcaaagac
ctctctattgttgtagccggtctgaaagaaggaaaaaagtacaaatttagagtggcagct
cgaaatgctgttggagtaagttttccaagagaagctgaaggagtatttgaaattaaagaa
caactcatcccacctaagatcctgatgcctgatcacgttcacattaaagctgggaagaag
ctgagaattgaagctcatgtatatgggaaacctcagccagtctgtaaatggctgaaagga
gatcaagatgtaattacatccagtcgccttgctgtgcataaagcagaaaagtcttctgtt
cttatcattaaggatgtgactagaaaagattctggtttttacactcttactgcagaaaac
agctctggtactgatagtcagaaaatcagagtgatagtcatggataagccaggtccacca
cagcctccatttgacatttctgaaatagatgctgatgcttgcacgcttgcatggcatata
cctcttgaagatggtggcagtaatattaccaactatgtagttgaaaaatgtgatgtaagc
cgaggagactgggtaacagctttagcttctgtcacaaagacaagctgcagaattggaaaa
ctgattcctggagaagaatatatgttccgtgttcgtgctgaaaatcgttttgggatttct
gagccacttaattctgacaagatgatagcaaggttcccatttgatgtacccagtgaacca
aagaatgcacgtattaccaaggttaataaggactgcatttttgttgcctgggatagacca
gatagtgatggaggcagtccaatcactggttatctcattgaacgcaaagaaaggaacagc
ttactgtgggtgaaagctaatgatacagctgtgcgttccacagagtacccttgtgtgggg
ctcattgaaggtcttgagtatactttcagaatttatgcactgaacagagctggagcaagt
aaacctagtaaaccaactgagatggtcacagcaaggacaccagtcgatcctcctggaaaa
cctgaagttattgatgtcactaagagtactgcatcgctggtatggacaagaccaaagcat
gatggtggtagcaagcttattggctactttgttgaagcttgcaaattacctggtgacaaa
tgggtccggtgcaatacaactccacatcaaatacctctggaagagtacactgctactgat
ctggaagaaaatgctcaatatcaatttagagcaattgctaagacagcagttaatattagc
caaccttcagaaccttctgatccagtgaccattcacccagaaaatgttcctcccagaata
gagttggatctgtctatgcaatcacagctaacagtaaaagctggaactaatgtacgtctg
gaggccaaagtatatggaaaaccaatgccaaccatcacttggaagaaagaaggagaacat
ttaaagccatcagaaggtgttaagataactactaagagaaatcttgctgttgttgaactg
ttcagtgttaacaggaagcaaacaggagactatactattactgctgaaaatgcaagtgga
tcaaagtcagcaactattaggcttaaagtacttgataagcctggtcctccagcctctgta
aaaatcaagcatatgtatgcagatcatgcaatgctttcttgggagcctcctctagaagat
ggaggttcagaaattactaattacattgttgacaaacgtgaaacaagcagaccaaactgg
gcccaggtcagcgccactgtaccaattacaagctgcacagtggagaaactaatagaaggg
catgagtaccagttccgtatatgtgctgaaaacaaatatggtgttggagaccctattttg
actgaaccagcagttgctaagaatccatatgatgtacctggaccttgtgatccgccggta
atcagtaacgttacgaaagacttcatgactgttagctggaagccaccagctaatgatggt
gggtccccaataactggttatatacttgagaagcgtgaaactaaagctcttaactggaca
aaggtaaacaggaagcctgtcattgaaagaactgttaaggcttcaggactccaagaagga
acagaatacgagttccgggtgattgcattgaacaaggctggacctggcaagcctagtgca
ccatccaaagcagtgtatgctcgtgatcctcaatatcctcctggcccacctgctttcccg
aaagtggttgacactactcgtaattcaataagcctgtcatggagcaaaccagcatatgat
ggtggaagccctatcattggttatctagtagaatcaaaaagagctgacacagacaactgg
gtcagatgcaatcttcccaagaacttgcaggctacacacttcgtggtaacagggctgatg
gaagatacagagtaccagttccgcatatatgctgtcaataagattggatacagtgatcca
agtgatgttcctgataaacacactgcaaaagatattttaattcctcctgaaggagaactt
gatgcagaactaaggaaagtacttgtattacgtgctggagtcacaatgagactttatgtg
ccagtaagaggacgaccacctcctaagattacatggtctaaagttggtgccaacctaaga
gacagacaaggattagacatcaaatcaactgattttgataccttcctgcgctgtgaaaat
gtaaacaaatatgatgctggaaaatacgtcctcagtctggagaatagttgtggtaaaaag
gcatacaccattgttgtaaaagtacttgatactccaggccctcctgttaaccttgttgta
aaggaagcatctaaagattctgcttacataacatgggaacctccactaattgatggtggc
agtccaatcacaaattatgttgttgaaaaacgtgatgcagaaagaaagtcatggtccaca
gtaacagcagaatgtccaaagacaagctacaggataaccaacctagaagaaggcaaatcc
tacttcttcagggtttttgctgaaaatgaatatggtattggtgacccctgtgaaactcgt
gatgctgttaaagcttcagaaacacccgggccagttgtggatctaaaagcttcagctgta
acaaaatcatcttgcaatttagtatggaaaaagcctatcagtgatggtggaagccgtatt
tttgcctatgttgtggaggttctcattggtgaagataagtggcaagaagtgatgcggtca
aagaaccttcattattcaatgaaagacctaaaagaaggacaagaatacacgttcagagtg
agagcccaaaatgatgctggatatggaactccaagggagctcacaattgtggcaagagat
gatgttgtggcacctgatcttgatttaagagatctacctgatttgtgctatgtagctaaa
gagggtagcaatttccgtcttaaaattcctattaaaggcaagcctttcccaactgtaact
tggaagaaagatgaagacaaggcacttacagagagtggaagagttgcttttgaatctacg
gcagtaaacacaacacttgtagtacatgactgccagaaagctgatgctggaaaatacaca
atcactctgaagaatgttgttggcagcaaggaaggcaccatttctgtgaaagttgttggc
aaacctggcataccaacaggtccagtgaaatttgatgaagtcactgctgatgccatgacc
ttaaaatggggtcctccaaaagataatggtggttcagaaatcactaactatgttctagag
aaaagagataatataagcaataagtgggtgacttgtgcctctgcagtccagaaaactaca
tttagagttacacggcttcatgaaggaaatgaatatacgttcaggatcagggctgaaaat
aaatatggagtaggtgaaggtcttaaatctgaccctgttgttgcaaaacatccatttgat
gtgcctgatgctcctccaccccccaacatcgttgatgttcgacatgattctgtatcttta
acttggacagatcccagaagaactggaggctcaccaatcacaggttatcatatcgaattc
aaggaaagaaatagtcttttgtggaagagagccaatacaattccaatcagaatgaaagat
ttcagagtgacaggattaactgaaggactggagtatgagttcagagtaatggcaatcaat
atagctggagtaggtaaaccaagtccaccatctgaacctgttgtggcacttgaccccatt
gatcctcctgggaaacctgaagttatcaatgtaacaaggaactcagtaacacttatttgg
acagaaccaaaatatgatggtggacataaattaactggctatattgttgaaaagcgtgat
ttgccttcgaagacttggactaaagctaatcatgtgaatgttccagactgtgcattcact
gtaactgaccttactgaaggttccaaatacgagttcagaattagagctaagaacactgct
ggggctatcagtcctccatctgaatccacaggaaccataatatgcaaagatgagtatgag
gcaccaacaattgttattgaacctactctgaaggaaggtttaacagtgaaagcaggagac
acaattactgtatctgctattagtatccgtggtaaaccacctccaacttcagcatggtca
aaagcaggaaaagattttagaccttcagagcttgtgcacattgaaactacacccacttct
tctaccctaaccatcaaatatgcagccagaaaggattctggagaatacacaatcactgca
accaatcctttcggcactaagcaagagagtgtacatgtgaaagttttagatgttccagga
cctccggggcctattgagatcagcaatgtttcagcagaaaaagccactcttacatggtca
cctcctgcagaagatggtggatcaccaatcaaatcatatattcttgaaaagagagaaact
agccgactgctctggacattagtggctgaaaatatcgagagttgtaggcatgttgttagc
aaactcattcaaggaaatgaatatgttttccgtgtctcagcagtaaatcaatatggcaag
ggtgaaccagtacaatcagaaccagttaaaatggtggacagatttggtccccctggtcct
cctggaaaaccagaagtaacaaatgtgactaaaaatactgtgacagttacctggaaaagg
ccagtagatgatggcggaagtgaaatcacaggttactatgtggagaggagagaaaagaaa
ggtctaagatgggtcagagcaacaaagaaaccagtttcagatcttagatgcaaagtaact
ggtctcctggaaggaagtgaatatgaattccgtgtcagtgcagaaaacagagcaggtgtt
ggaccaccaagtgatgcttcaaactcagtcatgtgcaaggatgttgcatacccacctggt
ccacctgcaaacccaagagtgactgatactacaaagacaagtgcatctttagcctggggc
aagcctcactatgacggtggtcttgacatcattggctacatagtggagcatcaaaaggaa
ggagaagaagaatgggtaaaagacacgacagggactgctttaagaatcactcaatttgtt
gttgctcatctgcagccaggagccaaatacaatttcagaatctctgccatgaatgctgta
ggtactggtgaaccagcactaattccaagtgtggaaatcaaagagcgggaagaaattcct
gactttgaattagacgctgagctaagaagaacacttgttgtcagagctgggttaactatt
cggatttttgtgccaattaagggacgtccaactccagaaattacatggacaaaagatgat
gtttcactcaaaggacgtgctagtattgaaaatacagactcttttacactcttgattgtc
acagagtgcaccagatatgatgcaggaaaatatgtaatgacacttgaaaatgctgctggt
aagaagactggttttgtaaatgtaaaagtcttggatacaccaggcccaccaataaacctt
aaacctagagaaatcaccaaggacagcatcaccctccaatgggatatgcctctgatagat
ggtggttcacgtataacaaactatattgttgagaaacgtgaatcaactcgtaaagcatac
tcaacggtcacaacaaactgccagaagtgttctttcaggattcctaatttgtctgaggga
tgtgaatactatttcagagtgttggctgaaaacgagtttggtattggtgaaccagctgaa
actgcagaaccagtaagggcttcggaggcaccgtccccacctgacagccttaatattatg
gatgtaacacgaaactcagttagcctggcttggccaaaaccagaacatgatggtggcagt
aagatcactggatatgtaattgaagcacaaagaaaaggaacaaaccaatggacacacatt
acaactgtaaaaacattggattgtgtagtgaagaatctaactgaaaatgaagagtatact
ttccaggttatggcagttaacagtgctggaagaagtgccccaagagaaagcaggccaatt
attatcaaggagcaaacgatgcttccagagtttgaccttcgtagtatctaccagaaaaca
gtcatcgccaaagctggtgacaatatcaagattgaaatccctgtgcttggtcgtccaagg
ccaactgtgacttggaagaaagaagaccagatacttaagcaaacacaaagggtaaattat
gaaaatactgcaacggcaaccatactaaccatcaatgaatgtacacgaggtgatagtggc
cgatatccactgtcagctaaaaatattgtgggagaagttagtgaagttattacagttcaa
gttcatgatatacctggacctcctacaggaccaatcaaatttgatgaaatttcttctgac
tttgtaacattttcatggcagcctcctttgaatgatggaggtgtaccaataagtaattat
gtcgtagagatgcgtcaaactgacagtaccacatggactgaactggcaaccacggtgata
cgtactacgtttaaagcctctcgtcttaatactggagttgagtatcagttccgagtcaaa
gctcaaaacagatatggaactggtccagccattacttcagaatctgtagttgccaactat
ccatttaaggtgcctggtccacccggtactcctcaggtgattgcagtcaccaaagaaact
atgaccattagctggaatgagccaattactgatggtggaagcccaattctgggttatcac
attgaaaggaaagaacgaaatagcattctttggcagactgtaagtaaaatgctggtatca
ggcaatatctttaaatcaactggacttagtgatggcattgcatatgaattccgtgttata
gcagaaaatctggctggcaagagtaggccaagcaagccatctgagcctgtatttgcttta
gacccaatagatccacctggtaaaccagtacctctgaacattacaagacatgcagtaaca
ctgaagtggactaaaccagaatataatggaggttttaagataactggctacactgttgaa
aaaagagatcttcctaatggccgttggctgaaggctaatttcagcaacatattagagact
gaattcactgtcagtggtttgacagaagatgctgcctatgaattccgtgtgattgctaga
aacgctggtggggctgttagtcagccctctgagccgtcagatgcagtaacttgtagagat
gacattgaagcaccaaggataagcgtggatgctaaatataaagacaccttagtgctgaaa
gcaggtgaagttttcagacttgaggctgatgtatcaggtcgccctccaccagctatggta
tggacaaaaggagaaaaagaacttgaagacacagcaaaactagaaataaagacagcagac
ttttctactgttcttatcaataaagattcttcaaggagagatggcggtgcctatacactt
actgcaacaaatcctggtggctttgccaagcatatcttcaatgttaaggttcttgatagg
cctggtcctccagaagggccattggctgtgtctgaagtcactgcagaaaaatgtgtgctg
tcatggttacctcctctggatgatggaggagcaaagattgagcactatgtggttgaaaaa
cgtgaaaccagtagattggcatggacagctgtagccactgaagttccactgactaaactg
aaggttactaagctgttgaagggcaatgagtatgtgttccgtgttatggctgttaacaaa
tatggagttggtgagcctcttgaatcagagccagttcttgcagtaaatccatatgtgcca
cctgatccacctaaaacacctgaagttacagcaataacaaaagattctatggttgtttgc
tggggccatcctgattctgatggtgggagcccaataactaactacattgtggaacgccgt
gacagagctggtcttcggtgggtaaaatgtaacaaacgagttgttactgacttacgttat
aaagtgtccggactgacagaaggtcatgaatatgaatacagagtcatggctgaaaatgct
gctggagttagtgagccaagcccaactagtccattctataaagcttgtgatactgtattt
aagcctggtcccccaggtaatcctcgtgttttggatagcagcaagtcctctattacaata
gcatggaacaaaccaatatatgatggtggttcagagatcacaggttacatggttgagatc
gcactacctgaggaagatgagtggaagattgtaactcctccagtaggactaaaggccact
tcttttactatcactgacctaaaagaaaaccaagagtataaaatccggatatatgctatg
aattctgaaggtcttggggaacctgctcttgttcctgggactcctaaagctgaagaaaga
ctgctacctccagagattgaacttgatgcagaacttcgtaaagttgtaactatcagagcc
tgctgtactctaagactctttgttccaattaaaggaagaccagcacctgaggtaaaatgg
acaagagaacatggggaatctctggatagagcaaccattgaatcaacaagctcttatact
ctacttattgttgaaaatgtaaatagatttgacagtggcaaatacatgttgacaattgaa
aacagctcaggcagtaagtcagcatttgtgaatgtcagagtacttgatactcctggggca
cctcaaaatttgaaaataaaagaagttacaaagtcatcagttacactcacatgggagcct
cctctcatagatggtggctctaaaataaaaaattacattgttgaaaagcgtgaatcaaca
agaaaagcttattcaactgttaatgccaattgccataagaccagctggaaagttgattca
ctgcaagaaggctgcaattactacttcagagtcctagctgaaaatgaatatggaataggc
cttccagttgaaacttcagaatctgtaaaagtatcagaaagaccacttccaccaggaaag
ataactttgttggatgtgacaagaaatagcgtatccttatcttgggaaaagcctgaacat
gatggtggtagcagaattctgggctatattgtggaaatgcaaagcaaaggcagtgacaag
tggtcaacttgtgctacagtaaaagttactgaagccactatcacaggattaatccaaggt
gaagaatacactttccgtgtttcagctcagaatgaaaaaggtgtcagtgatcctcgccag
ctgggtataccagttgttgcaaaagaccttgtgattccaccagctttcaaactactgttt
actactttcagcgttctagcaggagaggacttaaaggttgatgttccttttgttggtcga
cccaaaccagcagtcctttggcataaagataatgtggcattgaagcagactaccagagtg
aatgcagaaagttcagaaaataacacagtgttaacgataaaagaagcatgcagagaagat
gtgggggcatatttagttaaacttacaaattctgcaggagaagcaactgagatcttaaat
attgttgtgcttgataaaccaggacccccaactggaccagtcaaagtagatgaagtaaca
gcagatagtattaccatttcttgggagccacccaagtatgatggtggtagctctattaat
aattacattgtagaaaaaagagatacttccaccaccatttggcagattgtgtctgctact
gttgcaagaacaacgataaaagcatgtagattaaagactggatgtgaatatcaattcaga
atcacagctgaaaacagatatgggaagagcacctacctcacttcggagccagttgtagcc
caatacccatttaaagttcctggtccacctggaacgccttttgtaacaaacgcatcaaaa
gacagcatggtggtacagtggaatgaaccagtcaatgatggtggtagcaagatcattggg
tatcacttggagcgcaaagagagaaatagcattctgtgggctaagctgaatagaacacct
attccagataccaaatttaagacaactggccttgaggagggtcttgagtatgagtttaga
gtttatgcagaaaacatagtaggcattggaaaagcaagtaaagcatctgaatgctatact
gcacatgacccatgtgatgctcccggtcgtccagaacctttaattgtcacaagaagttca
gtaacacttcagtggaagaaacctatatatgatggtggaagtaagattacaggttatgtt
gttgaaaagaaagaactacctgatggtcgctggatgaaagcaagttttacaaatgtaatt
gatacccaatttgaagtaactggtctggttgaaaaccagagatatgagttccgtgttata
gcacgaaatgctgcaggtgttttcagtgagccatctgagagttcaggtgccattacagca
agagatgaagtagaaccacctcatataagtatggatccaaaatacaaagacacaattgta
gtacatgctggtgaatcgttcaagttggaagctgatgttcatggcaaaccaataccttcc
attcagtggctaaaaggtgatcatgagctgacaaacactgctcgtatggaaattaaaagt
acggattttgcaacaagtcttagtgtgaaggaagctattagagttgacagtggtcagtat
gtgctattggcaaagaatgttgcaggcgaaaagaaagttcctgttcatgtcaaagttctt
gatagacctggaccaccagaaggacctgttgagattacaggtgtcactgctgaaaaatgc
atgttatcatggaaacctccgctacaagatggcggtagtgatatttcacattatgttgtg
gaaaaaagggaaaccagtcgcctggtttggactgtcgttgattcaaatgtgcaaacgctc
agttgcaaagtaactaaacttttagaaggaaatgaatacattttccgtatcatggcagta
aacaaatatggcgttggtgaacctcttgagtctgaaccagtacttgcaaagaacccattt
gtagtgccacttccaccaaaggcaccagaagtcacagccattaccaaggattctatgata
gttgtttgggaaaggccagcctcggatggaggtagtgaaatcctaggctatgtccttgaa
aaacgggacaaggaaggtattcgctggacaagatgtaacaaacgcctgataagtgaactg
cgatacagagtgactgggctgatcgaaaatcataattatgagtacagagtttcagctgag
aatgctgctggtctcagtgaaccaagcctaccttctacttactataaggcatgtgatcct
atttataagccaggaccacccaataatcctaaggttgtggatgttacaagatcatcggtt
ttcctttcatggagcaaacctatctatgatggtggctctgaaattcagggatacattgta
gaaaaatgcgatgtaagtgatggtgaatgggctatttgtacccctccaactggaattaag
aacacccatatggaagtagaaaaactagtggaaaaacatgaatacaaattccgtgtctgt
gcagttaataaagcaggagttggagatcatgcagatgttcctggttctgttattgtggaa
gaaaagatggaggctccagaccttgacctcgacatggaattaaggaagattgtaaacgtg
agggcaggaggttccttgagactgtttgttcccatcagaggtcgtccagcacctgaagta
aaatggggtaaagtggatggtgagatcagagaggcagccattattgacaccactagcagc
tttacttcccttgttctagacagtgtcaacagatttgatactggaaagtataccctgact
ttagaaaacagcagtggaacaaagtctgcctttgtcagtgtaagagtactggatactcca
agtgcacctattaatttaaaaatcagagagatcactaaggactctgtttcactttcatgg
gagcctcctctcttggatggtggagcaaaaataaagaattacattattgaaaagcgtgaa
gcaacaagaaaggcatatgcagctgttgtaacaaactgccacaagacttcatggaaagta
gatcaacttcaggagggctgctattatttctttagaatctctgctgagaatgaatatgga
attggcctccctgcggaaaccagtgacccaattaaagttgctgaagttcctcagcctcct
ggaaaaataacagtggatgatgtcacaagaaacagtgtttcactaagctgggcaaaacct
gaacatgatggtggcagcaaaatcatacagtatattgttgaaatgcaagcaaagggtagt
gagaagtggtcagagtgtgctcgtgtgaaaacacttgaagcagttattactaacttaact
caaggggaagaatatctttttagagtaatggctgtaaatgaaaagggtaagagtgatcct
agagcacttgcggttccagtagttgccaaagacttggtgattgaacctgacgtaaggcct
gcttttcacagttacagtatccaagtgggacaagatctgaaagtagaagtaccagtttct
ggtcgacctaaaccaactgttacctgggtgaaagatggccagacactaaggcagacaaca
agagtcaatgttagtgatttgacagatctcactgtactgaatattaaagaaactagcaaa
gaggacactggtacttacgaaatcacagtggctaatgttgttgggcagaagtctgcctct
attgaaattataactctagacaaacctgaccctccactaggacctgtgaagtttgatgaa
gtaagtgcagaaagtgttaccttgtcatggaatcctccagcatacacaggtggctgtcaa
atcaccaattatgttgttcacaagagagatacaactaccactgtatgggaaacagtttca
gctactgttgcaagaactgtactaaaggtgactaaactaaaaactggttcagaatatcag
ttcagaatatttgctgagaacaggtatgggcagagctttgcgttggaatctgcaccagtt
gtagcacagtacccatacaaagaacctggacctcctggcacaccgtttgtgacaatagtt
acaaaagactccatggttgtacaatggcatgaaccaataaatgatggtggcagtaaggta
ctgggctaccatcttgagagaaaggagaaaaacagcatcttatggactaaagtgaataaa
actattattcaggacactagttttaagacaactaaccttgaagaaggaattgaatatgaa
tttagagtttctgcagaaaatattgttggtataggtaaaacaagtaaagtttctgagtgc
tacgtagctcgtgatccatgtgatcctccaggtcgcccagaagctataataataaaaaga
agctctattactctacagtggaccaaaccagaatatgatggcggaagtaaaattactggg
tatattgtagagaaacgtgacttaccagatggtcgctggatgaaagctagtttcacaaat
atcattgaaactcagttcactgtaacagggcttactgaagaccaaagatacgaatttaga
gtcattgcaaagaatgctgcaggtgcagtaagtaaaccttctgacagtactggaccaata
acggcaagggatgaagttgaactcccacgaatttcaatggatccaaagtacaaagacaca
attgttgtaaatgctggtgatacattcagacttgaggctgatgttcatggaaagccacta
ccaaccattaagtggtacaaaggagataaagagcttgaggaaactgctagatatgagata
aagaacacagatttcaatgcattaataattgtaaaagatgctattagaattgatggtgga
cagtttattttagaagcctctaatgttgcaggaacaaagacagtaccagtaaacgtaaaa
gtcctggatagaccaggccctcctgagggccctgtccaagtaaccggagttacagctgaa
aaatgttcactgtcatggtctcctcctcttcatgatggtggcagtgatatttctcattat
attgtagagaagagagaaactagtcgcctagcatggactgttgttgcttcagaggttgta
cctacaatgttgaaagtaacaaaacttttggaaggaaatgaatatattttccgtattatg
gcagttaacaaatacggagttggtgaaccactggaatctgtgccagtaatgatgaaaaat
ccatttgtggttcctagtccaccaaaggccttggaaatcaccaacatcacaaaggattct
atgactgtctgctggagccgaccagacagtgatggtggtagtgaaatcataggttacatt
gtagaaaagagagatcgagcaggtatcagatggataaaatgcaacaaacgacgaattaca
gatttgcgactaagagttacaggactaacagaggatcatgagtatgaattcagagtttct
gctgaaaatgctgctggattgggtgagccaagccaagtttccccttactttaaagcttgt
gaccccattttcaagcctggcccgcctacaaatgcccatgttgtggacactactaaaagt
tcagttacacttggctggagtaaacctatttatgatggtggctgtgaaatccagggatat
cttgtagaaatctgcaaagcagatgaagatgaatggtcacttgttactccacagacaggt
atacgtgccactcgatttgaaatcaaaaagcttactgaacatcaggaatacaaactacga
gtttgtgctctcaacaaggttggtgtaggagaggctgcatcagttcctggtactgttaaa
ccagaagacaaacttgaagctccagaacttgatattgattctgagctaaggaaagggata
gtggttagagctggtggttctgctaggatccacataccattcaggggacgaccaatacct
gacatcacgtggtctcgagaagaaggtgaattcacagaaaaagttcaaattgataaaggc
ataaactacacacaactctcaattgacaactgtgatagaaatgatgctggaaaatatatt
cttaagttggagaacagcagtggttctaaatctgcatttgttacagtaaaagtcttagat
acaccagggccaccacaaaacttaatagtaaaggatataaagaaagattctgctgtacta
tcttgggaaccaccgattattgacggtggtgcaaaggtaaagaactacgtaatagacaaa
cgtgagtcaaccaggaaggcatttgcaaatgtaagcgcgaagtgtggcaagacaagcttt
aaagttgaaaatcttacagaaggagcaatctattacttcagagtcatggctgagaatgaa
tttggaattggtgttccagctgaaacagcagatgctgtgaaagcttctgagccacctctg
cctcccggaaaagtaacactcactgacgttactcagagaagtgcgtcacttacatgggaa
aaacccgaacatgatggaggtagcagaattttgggatacattgttgaaatgctgcctaaa
ggaacagaaaaatggagtgttgttagtgagaccaaaacatgcagtgcagttgtttctggt
ctgagttcagggcaagaatatcaattccgtgtgattgcctacaatgaaaaaggcaaaagt
gatcccagagcacttggagttcctgtgatagctaaagacttgacaattgagccaagtttt
aagttgatgtttaatacatacagtgtacaggctggagaagatttgaaagtagaagtacca
tttataggtagaccaaaacctactattacttggacgaaagatgaacagccactgaaacaa
acaaccagattaaatattgagaatacatcaacatcaactatcctacatattaaagaaagc
aacaaagaggacttcggtaaatacacagtaacagcatcaaacacagcaggcacagcaagt
gagcaactgagtataatcgtactggaaaaacctggcccaccacgaggacctgtgcgtttt
gatgaagttagcgcagactttgttgttttatcatgggatccacctgattatactggtggc
tgtcagataagcaactatatagtagaaaagcgtgacacaagcactaccacatggaatatt
gtgtcagcaactgttgcaagaacaactatcaaagcaacaaagcttaagacaggttctgaa
taccagttcaggatttctgctgaaaatagatatggaaagagctctcctttggactctaag
ccagttgttgtgcaatacccctacaaggtgcctgggccacctggaaccccatttgtaaca
gcagcttccaaggaccatatgattgtacaatggaatgaaccagttaatgatggaggaagc
aaagttcttggctaccatcttgaacgtaaagataagaacagcattctttggataaaacag
aacaagtcactcattgcagacaccacatataaaacagatggccttgaagaaggccttgaa
tatgagttcagagtttctgctgaaaacattgttggcattggcaaagtcagcaaagtatca
gagttatatgttgcccgagatccatgtgacccacctggccgcccagaggcaattgttgtt
acaagaaataacattacactgaggtggaagaaaccagaatatgatggtggaagcaaaata
actggatatattgtagaaaagaaggaactaccagatggtcggtggatgaaagccagcttt
acaaatgttttagaaacagagtttacagttagtggtcttgttgaagaccaacgatatgaa
ttcagagtcattgcaagaaatgcagctggttgcttgagtgaaccatctgaaagtacaggg
cccattacagccagagatgaaattgaagcaccgggagcttctctggatcctaaatacaga
gatgtcattgttgttcatgctggagaaacctttattcttgaagctgatattcatggcaaa
cctattcctgacattacatggtcgaaagatggtaaagatcttgaagaagcgactgcaaga
atggaaattaaatctactattcaaaaaacaactcttacagtcaaagactgtgtaagagta
gatggaggtcactatactcttaacctcagaaacgttggtggcacaaaatctatacctatt
actgtgaaagtgcttgacaggccaggacctccagaaggacctttgaaggttacaggtgta
acagcagaaaaatgctacttggcctgggctccacctttacatgatggtggttctagtatc
tcacattatatcattgagaagagggagacaagcaggctttcatggacacaagtagctaca
gatgtgcaggcccttaaccacaaagtaactagactccttgctggcaatgagtacattttc
cgtgtaatggcagtgaacaaatatggaacaggagaacccttggaatctgagccagttgtg
gctcgtaatccatacaaacctcccggtcctccttcaacacctgaagtttcagcgatcaca
aaagactcaatggttgtaacatggggtcgtccagaagacaatgggggagctgaaattgaa
ggatacatacttgaaaaacgagacaaagacggtgtccggtggaccaaatgcaataagaaa
cggctgacagacttgcgattccgagtaacaggtcttactgatgggcatttctatgaattt
agagtttctgctgaaaatgctgctggtgtaggggaacccagtgagccatccattttctat
cgtgcttgtgatgtattatatccaccaggcccaccaagcaatccaaaggttacagatact
tccaggtcatcagtttctcttgcctggggtaagcccatttatgatggtggtgctccagtt
aagggatatgtagtagaagcaaaagaagcagctgctgatgaatggactacttgcacccca
ccaacagggctacaagcaaaacaattcactgtaacaaaacttaaagagaaccaggagtac
aacttccgcatctgtgccatcaactcagaaggagtaggagaacctgctgttatacctggc
acagttttagcagcggacaagattgaacctcctgaaattgaacttgatgcagatctcaga
aaagtagtcattgtacgtgccagtggtaccttacgtctgtttgtcactatcaaaggaaga
ccagaacctgaagttaaatgggagaaagcagaaggaacaattagtgatcgagctcagatc
gaagtcactagttcctatacaatgttggtaattgacaatgtgaatcgatttgatagtggc
agatacaatctaactttagagaacaacagtggcaaaaaatcagcttttgttaatgtcaga
gtgcttgatacacctagtgcaccagtaaacctgacagtcagagaagtgaaaaaagatttc
gtaacactagcgtgggaaccaccacttattgatggtggagctaaaattaccaactatgta
gttgaaaagcgggaatctacaagaaaagcatatgccacaattacaaataactgcactaag
aattccttcaaaattactcagctacaagaaggatgtagttattatttccgtgttctagct
gtaaatgaatatggggctggcttaccagcagaaacacctgagccaattaaggcttcagaa
ccaccttctccacctgcaaaggtcattcttgttgatgtaactcgcaactctgcttcgatt
aaatgggaaaagccagagagcgatggtggcagtaaaattactggttacatagtagaaatg
caaactaaaggaagtgtaaaatggagtgcatgtacccaagtaaaaacattagaagcaaca
ataacaggattaagtatgggagaagaatacagtttcagagtgattgctactaatgaaaaa
gggaaaagtgatccaagagaacttggtgtcccagtcattgcaaaagacattgaaatccag
ccatctgctgagctccttttcaacacattcactgtgaaagctggagatgatcttaagatt
gatgtgccattcagagggcgacctcttccatccattagctggaagaaggatgggaatccc
ttgaaagagacaaccagggtgaatgttcagacatcaaagacttcaacttcactatccatc
aaggaggcttcacatgaagatgtgggacattatgagttacatctctcaaattctgctgga
tcaacaactgcttctttaactgtagttgtccttgacagaccaggaccaccaactgatgtt
catattgaggaagttagtgctgatagtgtaactttgtcttggaaacctccagaatatgat
ggtgggtgccatattagcaattacattgtggagaaacgagacactaccacaacaacctgg
gacatagtatctgcagcagttgcaagaacatcaattaaagtatcacgactcactactggt
tctgaatatcagttccgtatttgtgcagaaaatcgttatgggaaaagcatacacgttaat
tctccatctgttgtggcagagtatccatttaagcccccaggacctcctggtactcctcat
gtggcacatgcaactaaagctttcatgattgtaacttggcaggtacctgttaatgatgga
ggtagcagagtactaggatatcacttggagcgtaaagaaagaagcagcattctttgggca
aaagtcaacaaaagtcttatacctgatacacaaatgaaagttacaggtcttgatgaaggt
ctgatgtatgaatatcgtgtgtatgccgaaaacattgcaggcataggcaaatgcagtaaa
tcatgtgaaccagttgctgcaagagatccgtgtgatcctcctggtcaaccagaagttact
aatattacaagaacatgtgtctcactgaaatggactaaaccagaatatgatggtggagct
aaagtaacaggatatattattgagcgcagagagatgccagatggtcgctggttaaagtgt
aatttcacaaatgtgcaagaaacatactttgatgtaggtggacttacagaagaccagcgt
tacgaattccgtgtgattgcaaagaatgctgctggactcttcagtcagccatctgaatca
actggacctgtgactgtaaaagatgatgtagaggctccaagaattatgatggatgtcaaa
ttcagagatgtagttgtgaaagctggagaagtgtttaaagtcaatgctgatattgcaggg
cggccaataccagtagtttcatggacaaaagatggcaaagaacttgaaggaaaagctaga
gttgaaatagcctcaacagaccacgctactgcaataacagttaaggactgtatccgaggt
gattcaggacagtatgtattaacattacaaaatgttgcaggaacaagatctttggcaatt
aattgcaaagtacttgacagacctggcccaccagcaggccctctagaaataactggcctt
actgctgaaaagtgtcatttatcatggggacctcctcaagagaatggaggtgcagatatt
gattattatgttgtagaaaaacgtgagaccagcagaattgcatggacaatttgtgaagga
gagcttaaaacaacatcctgtaaagtgacaaaactgctgaaggataatgagtatattttt
agagtgatgggagtgaacaaatatggtgttggcgagcctctagaaagtgttgctgtcaaa
gccttagacccatttactgttccaagtccacctacttctttggagatcactagtgtaagc
aaagattcaataactttgtgctgggcaagacctgagtctgatggaggcaatgagatctct
ggctatgtaattgaaagacgtgagaaaactagcctaagatggatacgtgtaaacaaaaag
ccggtgtatgatttaagagtgaaatcatctggtctccgtgaaggatgtgaatatgaattc
cgagtttatgcagaaaatgctgctggtctcagccttccaagccaaagcacaccattaatt
cgggcagaagatccaatcttcttgccatctcccccatctaaaccgaagattatggattcc
acaagatcaaatatcacaattgggtggacaaagccactgtttgatggaggtgctccagta
actgcatacacagttgaatacaagaaaactgatgaaactgagtggacaactgctattcag
aacttaagaggtacagagtacaccataagtgggttagtgtctggctctgaatatgtcttc
agagtgagatccatcaacaaaatgggtgtcagtgaaccaagtgacagctcagaacctcac
ttggcaaaagaaagagaggaagaacctgcttttgatattgacagtgaaatgcgaaagaca
ctaattgtaaaggctggtgaatcattcacaatgacagttcctttcagaggcaaaccagtc
ccaaatgtaacatggaacaaaccagatactgatctccgtacacgagcaagcattgatgtt
tcagataattgcacatctcttactattgaaaaggcaacaagaaatgattctggaaaatac
acgttaacgttacaaaatgtcgtgaacactgctaccttgactttagttgtcaaagttctt
gacactcctggcccgccatctcatgtaacaacaaaagatgtaactaaagaatctgctgtg
ttatcttgggatgttcctgataacgatggcggggcacctgtgaagaactatgtcattgaa
aaacgagaagctagcaagaaagcatgggtcactgtgacgaataattgtcatcgcctgtca
tataaagtaactggcttacaagaaggtgccatttactacttccgagtttctggagagaat
gagtatggtgttggagtgccttctgagaccaaggagggaactaaaataacagaaaaaccc
agcccaccagaaaaacttggagtgacgaacgtcacaaaggacagtgtttctctgtcatgg
ctaaaaccggaacatgatggtggaagcagaattgtgagctacctcattgaggctcttgag
aaaggacagcagaaatgggttaagtgtgcagttgtaaagacaactcatcatgttgtccat
ggtcttaaggagaatgttgactatttcttcagagtgtctgcagaaaaccaagcagggtta
agtgatcctaaggaactacttcttcctgttacagttaaagaacaattagaatctcctgag
atcgacatgaagggcttccctcacaatactgtgtatattcgagcaggttcaaacctgaaa
gttgaaattccagtttctggaaaaccattgccaaaggtgacattgtctagagatggcgct
ccaatcaaacccaccttgaggtttcacacagaaatgacagcagaaagtttcattgttaac
cttaaagaaagtgtggctgctgatgctggcagatacgatattactgctgccaattcaagt
ggcaccacaaagtcattcattaatattgttgtgctggatagaccaggtcctcccgttggt
cctgttgtccttagtgatatcactgaggagagtgtaacactcagatggcagccaccagct
tatgatggcggaagtcaagttaccaactatattgtactgaaaagagaaacaagtacagct
gcctggtctgaggtatctgcaactgttgctagaactgttattaaagtcatgaaactcaca
actggagaagaataccaattccgcatcaaagctgagaaccgctttggcatcagcgatcat
gttgactcacaatgtgtagttgtcaaacttccctacactacccctggtcctccttccaca
ccgtgggtcactagtgtcacccgagagagtattacagttggatggcacgaaccagtcact
aatggtggcagcgctgtcgttggataccacttggaaatgaaggataggaatagtatatta
tggcagaaggctaacaagatcctcattcgcacaactcactttaaagtcaccaccatcagt
gccggacttatctatgaatttagagtttatgctgaaaatgcagctggcattggaaaagca
agtcatccttctgatccggtccttgcaattgatgcttgtgaaccaccaagaaatgttcgt
gtctcagatatttccaagactgctattactttgtcatggcagaagccagcatttgatggt
ggtagcaagatcactggttacattgtagaaaaacgtgatctaccagatggcagatggtca
aaagctagtttcaccaatgttattgagactcagttcacagtatctggtctgacacagaat
tcccggtatgaattccgagtctttgccaagaatgccatcggttccattagtaatccatca
gacgttgtgggtcctattacctgtgttgatacatatggtgcacctgaaatcgatgtgcca
ccagaatatacagaagtagtgaaatacaaagcaggaacttctattaagctaaaactaggc
atctcaggaaagcctacaccaacaattgaatggttcaaaaatggcagtgagctgcaaacc
agttcactactgtctattgagaacacaacagaatttgcttctatcctcatcaaggatgca
acccgacttaacagtggcacctatgaactaaaattgaagaatgccatgggatcagcatca
gcccatgttagagtacagatacttgacaaacctggacccccaactggaccaatacagttt
aagacagtcactgctgaaaagatcacaataatgtgggaccctccagcagatgatggtggt
gcacctgtaacacattatgttgttgaaaagcgggaaacaagtcgtgttgtatggtcttta
gtttctgagaaacaggaggggtgtattataactacaacaaaacttgtcaaaggaaatgaa
tatgtgttccgtgtccgtggtgtgaacaagtttggagttggtgattccttggagtctgaa
ccagttatagccaaaaactcatttgttgcacctggaccacctggtgtaccagaagtcaca
atgataaccaagaattctatgactgttgtctggagtaggcccactgttgatggaggtagc
gaaatatcaggatattttcttgagaagcgtgacaagaagagtcttagctggttcaaggtt
actaaggaaaccattcgtgacaccagacagaaagtaacgggtctgactgaaaacagtgaa
tatcatttccgagtttgtgctgtcaatgcggctggacaaggtccattctgtgaagcatct
gacttctacaaagctgtagatcctgttgataagccaggctcaccaacaaaattgaaggtt
gtggatacaactaagacatctgtcacccttggctggattaaacctacttatgatggagga
agcccgattaccagctatgtggtcgagaaaagggaaggtgaagagcaagaatggactgta
gtcagctctaagggagaagtgagaacaactgaatatgttgtatcccaccttcagccaagc
attaattattatttccgtgtctctgctataaattgtgctggacaaggagagcctattgaa
atgacagagcctgttcaagctaaagatattctcgtggccccagagattgatctggatgtt
gccctccggacctctatcattgctaaagcaggtgaagatgtggaaataatgattccattc
aaaggaagacctcctccaactgtcacatggagaaagggtgaaaaaaatcttggaactgat
gaaaaatatatcatccagaacacagaatcatcaacattactttctattcctcaagttacc
cgagatgatacaggaaagtatgttcttacaattgaaaatggagttggagaacccaaatca
tcatttgtgaatgtgaaggtacttgacacaccatctgcctgccagaagctacagcttaag
catgtttctcgtggcacagttacactggtatgggagccacctctcattaatggtggttct
gaaataacgaattatgttgttgaaaaaagagatgctacaaagagggcctggtcaactgta
acaacaaagtgttctcaaactacctttaagctaactaacctgtcagaaaagactgcgttc
ttcttccgtgttcttgctgaaaatgaaattggactgggtgagccttgtgagacatctgaa
ccagtgaaagctgcggacataccaggacctataaaagaccttgccatgaaagattctaca
aaaacttctgttaaattgcattggagcaaaccagactatgatggtggtagcattatatca
gactacattattgaaaagaaattgcagggcgaaaaggaatggacgtacgcaggcacaagc
aagagctgtgaatttgaagttgaaaaacttaaagagctgtctgtcatggaattcagagtt
tttgcaaaaaatgaaaaaggcatgagcgatggtgttactgttggacccattacagtgaaa
gaatatataataacaccagaagctgacctttctgacattcctggaggtcaagtcactgtg
cgaattgggcataacctacacattgaattgccctataaaggtaaacctaagccatcaatg
agctggctgaaggacaacctccctcttaaagaaactgaacagcttcgtttcaagaaaact
gaaaacaaaataagcttaagtatcaagaatgtgaaaaaggagcatggtggcaaatatact
ttgattcttgataatgttgtctccagaaaaacatttacaatcactgtcatcactcttggt
ccaccatctaagccaaaaggacccttaagactagatgaagtcaaagcagatagtgtagtt
ttgtcatgggaagctcctgaagatgatgggggaggtgaaatcactggctacagtattgag
aaaagagaaacttctcaaatgaactggaagctggtgtgctcgagtgctgctagaacaact
ttcaaagtaccaaacctcgttaaagacactgaatatcaatttagagtccgtgcagaaaac
agatacggagtaagcccacctcttgtctcagtagatgttgtggcaaagcatcaattcaga
acaccaggtgcaccaggcaagcctgttgtatacaatgtaacagctgatggaatgaccata
gcttgggatgctcctgcttatgatggcggttcagaaatcattggctaccacgttgaaaag
aaggagagaaacagtattttgtggcagaaggttaatgttgcattaatatctagcagagaa
tacaggattactgggctagttgagggtctggattaccagttccaagtgtatgcagaaaac
gctgccggtctaagccgagccagcgagccaagcaagtttactttggcagtttctccagta
gatccacctggtactcctgattatattgatgtcaccagagaaacagtcactcttaaatgg
acccccccactgcgtgatggaggcagtaagattgtggcctacagtattgagaagcggcaa
ggaagtgaagaccggtggctgagatgtaactttactgatgtcagtgaatgccaatataca
gttacaggactcagtccaggtgatcgatacgaattcagagtgcttgcaagaaatgctgtt
ggtaccatcagtccaccttcacagtcctcaggctatatcatgaccagagatgaaaacgtt
gctccaacaattgaatttggccctgagcactttgaaggcctaactgttaaagctggagag
agcattagacttaaagctttaatcaaaggacgtccagtacctaaggtgacgtggtttaag
gatggcaaggagattgaaaaaacaatgagtatagaaataactacagatattggatatagc
acaatcttcattagagatgctacccgggatcatcgtggagtgtacacagtagaagccaaa
aatgcatcaggcactaaacgagaagatattacattcagaatacaagacacaccaggaaaa
gttggtggaccaatacgattcacaaacatcactggagaaaaagtgacattatggtgggag
cctcctgctaatgatggttgtgcttgtatttcccactacatcattgaaaagcgtgaaacc
agcaggattgcatgggcattagttgatgacaagtgtgaagcttgcagctacactgcactt
aaattaattaaaggcaatgagtaccagttccgtgtctctgcagtaaacaaatttggagct
ggcagaccattggagtctgatccagttgtagcacaaatcccttacactcttcctgatgcc
ccaggaacaccagagcccaccaacgtaacaggagacagtatcactctgacatgggcaaga
ccaaaatcagatggtggaagtgagataaatgaatatattctagaaaggagagaaaagaag
agcatgcgctgggttaaagtgaccagtaagaggcccattgctgagaacagatacagagta
actggccttattgaaggcaatgaatacgaattccatgtcatggctgaaaatgctgcagga
attgggcctccaagtgatgtttcaaagctaattaaatgcagagaaccagttagcccacct
agtgcacctaatgtcgtaagggtgacagatacatcaaagactagtgtaagcttagagtgg
accaaaccagtttttgatggcggtatggaaataatcggatacattattgagatgtgcaaa
gctgatctagaaacatggcagaaagtcaatgcagagactgttcttgctactaaatatacc
gtggttgatctggaggcaggagaacactataaattcagagttagtgcagtcaatggtgct
ggcaaaggagaaagctgtgaagttcctgcatcagtccaaactgtagacaggctttctgca
cctgaaattgacattgatgcaaacttcaagcagactcacattgtaagagcaggtgcaact
attcgcctatttattgccttctctggaagacctgttcctactgctgtttggtccaaagca
gatgcaaatctgagcttgcgtgctgacatacaaaccactgactcgtttagcacattgact
gtggaggaatgcaatagaaacgatgctggcaaatatgtctttactgtggaaaacaacagt
ggaagtaagtcaattacatttactgtcaaggtgttggacactcctggtccacctggtcct
attacatttaaggatgtgacccgaggatctattactttaatgtgggatgctcctgtgctg
gatggaggttcacgtattcatcactatgttgtggaaaaacgggaagcaagccgtcgtagc
tggcaagtggtgagttcaaaatgcactcgacaaatctttaaggtcactgatctggcagaa
ggtgtcccatattattaccgagtgtcagcagaaaatgaatatggtgtaggcgaaccttgt
gagttgacagaaccaattgtagccactgaagaacctgcaccacctaagagattagatatt
gttgatactaccaaatcttctgtagttttagcttggcttaaacctgaccatgatggtggt
agtcgtgttactggataccttcttgaaatgaaacagaaaggctctgacaaatggattccg
gctggtcaaaccaagcaacttactttcactgttgaaggcctagtggaaaacactgaatat
gagttccgggtcaaggcaaagaatgatgctggctacagtgagccaagagaagctttctct
tctgttattattaaagagccacagattgaaccaacagcagatctaagtgaaataagcaga
cagctcataacatgcaaggctggaagcacttttactattgatataccaattagtggccgc
ccagctccaaaagtgacatggaaacttgaggagatgaggctgaaggaaactgagagagtt
gccatcaagacaacaaaagacagaaccacgctgactgtaaaggacagtatgagaggagac
tctgggaaatactacctcacgcttgaaaacactgctggtgtgaaaacatttactgtcaca
gtggtagtcataggacggccaggtccggtcactggcccaattgaaatatcatctgtctct
gctgaatcctgtatattgacctggaaagaacctgaagatgatggtggcagtgatattaca
aactacattgtagagaagcgtgaatctggcacaacagcatggcagctggtaaattcgagt
gtaaaacgtacacagatcaaagtcacccgtctcacaaaataccaggagtacagttttcga
gtaagctcagaaaacagatttggagtcagcaaaccccttgaatcaaaaactatagtagct
gaacatccatttgtcccaccaagcccacctacaaggccagaagtctattccgtgtctgca
aatgccatggcaattcgctgggaggaaccctatcatgatggtggcagcaaagtcattgga
tactgggttgaaaagaaagagcgcaacaccatcctttgggtgaaggaaaataaagtgccg
tgctgtgaatgcaacttcaaaatcactgggctggtggaaggcctagaatatcaattcaga
acctatgctctaaatgctgcaggtgttagcaaagctagtgaagcttccagacctgtagtg
gctcaaaatccagttgatccaccaggaaggccagaagtaacagatgtcaccagatctaca
gtgtccctgagctggtcaccaccactttacgatggtggaagtaaagttattggatatatt
attgagcggaaaccatataatgaatctggcgatggacgctggctgaaatgcaattatacc
atagtctcagaaaacttctttacagtgacagctctcggtgaagatgaagcgtatgaattc
cgtgtactagcaaagaatgcagctggtgtgattagcaaaggatctgaatcaaccggtgct
gtcatttgcaaagatgaatactcaccaccaaaggctgaactcgatgccagattgcaggga
gaagttgtaactattagggctggatctgatcttgttcttgatgcggccattggtgggaaa
ccagaaccaaaagtcttctggtccaaaggagataaggaattggacctatgtgaaaagata
tctctgcaatacaccagcaaacgagccattgcaattatcaagttctgcgacagaagtgat
agtggaaaatatactctaacagtgaaaaatgccagtgggacaaagcaaatttctgttctt
gtcaaagtgcttgattcaccaggtccatgcgcaggaaaaataacagtaagcagaataact
gaagagaagtgcactctggcatggaatattcctgaggaggatggaggtgcacaaatcact
cactacattgtagaaaggcgcgaaaccagcagacttcactgggttattgttgaggccgaa
tgccagacattgtcatgtgtggtaacaaaacttattaaaaataacgagtacatcttccgt
gtcagaggtgtcaacaaatatgggccaggtgttccacttgaaacagaacctgtcattgcc
aggaatgctttcactatcccaacacagcctggtactcctgaagaagtgagtgttggcaag
gaacacatcatcattcagtggacaaaaccagaatcagatggtggcagtgagattaaggat
tatcttgtagacaaacgtgaaagaaaaagtctgcgctggacacgagtgaacagagattac
actatttatgataccagactgaaagttactggtcttatggaaggtggtcagtaccagttc
cgtgtcactgctgtgaatgctgctggaaacagcgagcctagcgaagcttcacaatatatg
ttatgcaaggaaccatcatatactcctgcagcaccttcagctccaagagttgtggacact
actatgcacagcataagtttagcatggtcaaagcccacatatgatggtggtgctgacatc
ttaggctacgttcttgaaatgaaggaagaaggtactgaacagtggtaccgaccacatacg
actcctactctgaggaatgctgagttcaccataactggtcttaaaacaagccagaaatac
cgatttagagttgctgctacaaatgtgaatggtatgagtgaatttagtgaatcatcagca
gaaatagaacctgtggaaagaatagaaaaacctgagcttgagcttgctgatgacctgagg
aagacagtaacagtgagagctggtggttccctgcgtctgatggtctctgtgtcgggcaga
cctgctcctgtaattacatggagcaaggagggtattgaccttgtaagtcgaggtattatt
gatactacagacagctacactctacttattgtggataaagttaatcggtacgatgctgga
aagtatgtaattgaagctgaaaatcaatcaggaaaaaaatcagcaacgatttctgtgaaa
gtgtatgatacacctggtccaccagctgctgtgagaattaaggaagtatcaagagattct
gcaacacttacttgggacattccaactattgatggtggagcccctgtcagcaattatata
attgagaaacgtgaagcttccatgagagcttacaagactgtcactaccaaatgcagcaag
acgttttatagagttactggacttctggaaggagctttgtattatttcagagtactgcca
gagaatatttatggtattggtgaagcttgtgaaacatctgatgcagtattagtatctgat
gtacctataccaccacaaaaactggaagtgatcgacaccaccaaatcaactgttactctt
gcttgggagaaaccagcacatgatggtggcagcagattgactggctatgttattgaggcc
agcaaagctggaacagaaagatggttgaaggtagtgacagtaaagcctaccgtctatgaa
catacaattatctctctcaatgaaggcgaacagtacttgttcagggtcagagcacagaat
cagaagggtgtttcagaagcacgagagattgtcacagcagtaacagtacaggaccaaaaa
gttctgccgacaattgaccttgccggaatacctcagaagacaattcatgtacctgctggc
aagcccattgagttagctattccaattggaggacggccacctccagctgcatcttggttc
gtggctggttctaaactaaaagaatcagaacgcatcaaaatggagactgttgccaaaatg
gctaaactgacagttcgtgagaccaccattcatgacactggagagtatacgcttgaactc
aagaacacaactggaacagtttctgatacaataaaagttataatccttgacaaacctggg
ccacctgttggacctatccgaattgatgaaattgattcaaattatgtaatcatctcctgg
gagccacctgagctggatggtggagctacacttagtggctatgtggtagagcagcgtgac
gcccaccgtcctggatggctgccagtttcagagtcagtaaccagaacaacatacaagttc
accaggcttgttgaaggtgcagaatacgtgttccgtgtggctgctacaaaccgctttgga
attggatcttacctgcagtctgagattatagaatgcaagagcagaattcgtatccctggc
cctcctggcactccagaagtgtttgatgtctctcgagatggtatgacattaacttggcat
cctccagatgatgatggtgactcacggattactggttatattgtggaacgcaaagaaatt
agagcagatagatggattcgtgcaaataaagttccagtcactatgactcgttaccgttcc
actggattggttgaaggattagaatacgaacaccgcatcacagcaatcaatgcaagaggt
gctgggaaacccagtcgtccttccaagtctgttgttgccagggatccaattgctcctcca
gggaaacctcagaatccaagagtcactgacactacaagaacatctgtctctctggcttgg
agtccaccagaagatgaaggtggctctaaagtcaccggctacttaattgagatgcagaag
gtagatcagtatgaatggaccaaatgcaataccactcccaccaagattcgtgaatacact
ttgacacatctaccacaaggtgcagagtacagattccgcgtgctagcctgtaatgctggt
gggccaggagaacctgctgaagtgccaggaacggtcaaaataacagaaatgcttgaatat
cctgactttgaacttgatgaaaaataccaggaaggtctcatggtgagacaaggtggagtt
atcaggcttacaatacccattaagggtaagcccattccagtatgcaaatggacaaaagaa
ggacatgacatcagcaaaagagccatgattgcaacttccgacactcacacagaacttgtg
atcaaagatgcagaaagagaagattctggcacctacgatctggcacttgaaaacaagtgt
ggcaaaaaagctgtgtatattaaagtcagagtgattggcattccaaatccaccagaaggg
cctcttgagtatgatgatatacaagctcgttctgtcagagtaagctggagacctcctaca
gatgatggtggtgcagatatactaggttatattgttgagagacgagaagtaccaaagact
gcctggtacactgttgattctagagtaaaagggacatctttggtagtgaaaggtctaaaa
gaaaacgtggagtatcacttccgtgtttctgcggaaaatcattttggcattagcaaatct
ctcaaatctgaagaaccagctgtaccgaagacaccgctgaatcctccagagcctccaaac
aacccacctgaagtgcttgatgtcacaaagagttcagttaacttgtcctggtccagacct
aaagatgatggtggttctcgtgtaactgggtactacattgaacgtaaggagacatctaca
gaaaaatgggtccggcataacaaaacgcagatcactactacaatgtacacagtcacggga
cttgttccagatgctgaatatcagttccgtgttgttgctcaaaatgaaattggtgaaagt
gaagcaagtcctgcttctgaaccagttatatgcaaggatccatttgacaaaccaagccaa
cctggagaaattgagatcacttcgatatctaaggacagcattacaatggaatgggaacga
cctgaaagtgatggtggcaaagagatccttggatactgggttgaatatcgacagtctgga
gaaagcacctggaaaaaatgcaataaagaactcatcaaggacagacagtttacagtagga
ggtttattggaggccacagaatatgaattccgtgtttttgcagaaaatcagactggcctc
agcagacctcgaaggactgctatggcagtgaaaactaaattaacatctggagaagcacct
gctataagaaaagaaatgcaggatgttacaactaaactgggtgaagcagctcagctgaca
tgccagattgttgggagacctcttcctgatattaaatggtaccgctttggcaaagaatta
gtgcagagccgaaaatacaaaatgtcatctgatggacgcaaccatacactgacagtatta
acagatgaacaagaggatgaaggtctctacacttgtatggctaccaatgatgtcggagaa
attgaaactagtggcaagctattgttgcaggctcctcctcagttccatcctggcttccca
ttgaaagagaaatactatgctggtgctggtggcactctccgccttcatgttgtgtatatt
ggccgaccagtaccagcaataacttggttccatggcaacaaacctctgagaggatcagaa
tcagttactattgagaacacagagcattatactcatcttgctattaagaatgtccagcac
aaaactcatgctgggaagtacaaagtgcaactcagtaacacatttggaacggttgacact
gtacttaatgtggaaatacaagataagccagataaaccagaagggccgatcgttatagag
tctgtactaaagaactctgtggtgattagctggaaaccaccagaggatgatggaggtgct
atgataacaaattacatcatagagaaacgtgaagccaaggaaggagcagaatgggaactt
gtatcttcaagcatttcaggcacaacttgtagaattgttaatctaactgaaaacgcaggc
tattatttccgtgtttctgctcagaatacatatggaattagtgaagcactggaagtctca
tcagttgtcgttatgaagcctccatttgaaaaaccaggacaacctggtcagccagtagca
agcgctgtcacaaaagattcctgtgttgtctcatggaagccacctgcgagtgatggaggt
gcaaagatcagaacatactatcttgagaagcgtgagaagaaacaaaacaagtggatttct
gtaacaacagatgaaattcgtgaaactgtattctctgtgaaagaccttattgaaggtctt
gaatatgagttccgtgtaaaatgtgaaaatctaggtggtgaaagcgagtggagtgaggta
tcacaaccagtcattccaaaatctgatgtaccaattcaagctccacatttcaaggaagaa
ctaagaaatctgaatgtgaaatttcaagctaacgccacatttgtctgcaaagtcactggt
catcctaaaccaatcgtcaaatggtacaggcagggcaaagaaatcatgccggatggtgaa
aagatcaaaatacaggaattcaagggtggataccaccagctaatcattacaaatgtaaca
gatgatgatgccacagtatatcaagttagagctaccaatcaaggaggatcagtgtctggc
actgcctctttggatgttgaagttcccgcaaagattcacttgcccaaaaacctggaaggt
atgggagccgttcatgccctccgaggggaagtagtgagcatcaagatcccattcagtggc
aagcctccccccgtgatcacatggcagaagggacaagatctcattgatactaatggacat
taccaagtcattgttacaagatcattcacatctcttgttttcccaaatggtgttgacaga
aaagatgcaggtttttacattgtttgtgccaaaaacagatttggaattgatcaaaaaaca
gttgaattagatgtggctgatgtgcctgatccaccaagaggtttgaaagtaacagacatt
tcaagagattcagtcaacttaacctggattgaaccagccactgatggtgggagcaggatc
ataaactacattattgagaaacgtgctacaacagcagagcgatggattcgtgttgcgcaa
gctcgtgatacacgatatacagtagtgaacctatttggcaagaccacctatcagttccgt
gtaattgcagaaaacaagtttggccaaagccagccttctgaacctactgatccaattata
acaaaggaagataagactagaataatgaactacgatgaagaggttgatgagaccagagaa
gtcaccacagctaaggctgctcactattctacgaaggaactctatgacaaatacatgatt
gcagaagagcttggacgtgggcagtttggcattgcacaccgctgtgttgaggcagtttca
aagaagacttacctagctaagtttgtcaaagtaaaaggtgctgaccaagttttggtaaag
aaagaaatttctattctaaacattgcgaggcaccgaaatatcctgcatcttcacgaatcg
tttgagagcctagaagaattggtcatgatctttgaattcatttcgggagtcgatatcttt
gaaagaatcagcacagcttcatttgaactgaatgaaagagaaatagtaagttatgtacgc
caggtctgtgatgcactagaatttttacatcgccacagcattggacattttgatatcaaa
ccagacaatattatttatttcacaagaaggagttctgtagttaaaattgttgaatttggt
caagctagacaactgaagcctggagacagctttagactccagttcacttcacctgaatac
tatgcacctgaagtacatcaccatgatctggtcagcacagcaactgacatgtggtcagtt
ggcgctctaacgtacatacttctcagtggcattaatcctttcattgctgaaacaaatcaa
caagttattgaaaatattctaaatgctgaatacaattttgatgatgaagcattcaaagac
ataagcattgaggctatggacttcatcgatcgcctgttagtaaaggaaagaaaagctcga
atgacagctgctgaagcacttaatcacacgtggcttaaacagaaaacagagaagaccagc
actaaaaccatcaagaccttaagacacaggcgttactaccacactctagtaaagaaggag
tggaacacagttgtgtcagtagcccgtatttcctgtggaggtgcaattagatctcagaag
ggtgtaacagtggctaaagttaaagttgctccaatagacatcggtcccattgctgggcag
ataaaccatgctgctgcagaagaaggagggcatgccaaatacgtgtgtaagattgaaaac
tatgatcagtccacacaggtcacctggtactttggtatgagacaactagaaaacaatgag
aaatatgaaatcaattatgaagaaggtgtggcgacaatgtacgtcaaagatgtttctaaa
tcagatgatggaacctatagatgcaaggttataaatgattacggtgaagacagctcttac
gcagaactttttgttaaaggtgtgagagaaatgtctgaacactacagatgtagagctgtt
aggaaagtgaaacgccgggttgatgcaatgagactcttagagcgtccaccagaatttact
ttgcctttgtataatcgcactgcatatgttggagaaaatgtcaggtttggtgtaactata
acagtacacccagaacctcgattaacgtggttcaaatcaggccagagaatcaaacctggt
gatgacgataagtatacttttgaatcagacaaaggtctttaccaactcatcatcaataaa
gtcactgaagaggacgatgccgaatacagtattgtagcacgcaataaatatggggaagac
agctgcaaagctaagctgactgtgattccgcatccacctccagcagatactacactgagg
ccaatgtttaaaaggctgctggccaatgccgaatgccaagaaggccaaaatgtcagtttt
gagatcagggtatctggtatacctaagccaacactgacatgggagaaagatggtcaacct
ctatcctttggtcctaactttgatataattcatgaaggtttagattactacgctttgcat
atcagagatactttaccagaggacagcggttattacagagttactgctacgaacagcgct
ggatctacaagctgccaggcttatctaaaagttgaacgcttgaaatatgtcaagcgtgag
tacaagactgaagaagagcgggagaagcatgtacaaaggcaaattgacaagaccttaaga
atggcagagatcctttctgggactgaagctgttccattgacacaaactgcacaagaggct
ctcagagaagctgctatcttgtacaaaccagctgtcagcactaagactgtcaaaggtgaa
tatgaaattaagaaagaagaaaagaaggaagaaagaaaacttcgtatgccgtacgaggtt
ccagagcctcgcaaacatgtgcgcactactcttgaggaagatcagaccattaaacacttt
gtgcctctgtcagatatgaaatggtacaagaggctgcgagaccagtacgaaatgccagga
aagcttgagagaactgttcagaaacgccagaaacgcatacgtctttccaggtgggagcag
ttctacgtgatgccactgccacgcatttctgatcagtataagcctaaatggcgcataccg
aagctaacacaagatgatcttgaaactgtgagaccagcacgtcggcgtgcaccgtctcca
gattacgaattttactacagaccaaggaggcggtcacttggtgatttatctgatgaggaa
ttactcctgcctattgaggattatttagccatgaagagaactgaagaggaaagactgcgc
ctcgaagaagagcttgagctaggcttttctgcttccccaccaagtagaagccccccacgc
tttgagctgtctgcacttcggtactcgactgcaggagcgcaggtccaatcagaggaagaa
agaaagagagagctgaggtattccagctaccatatcccagctaaagctgacacaagcgca
agctatgcagagctacgtcagcgctatgacagagctgcctacagaccccccaaacaaaag
caaagaataatggctgaaagagaggatgaagaattgctccgtcctgttggtgctactcaa
agactctctgagtacaagagtgagctggaatatatggcagaagaggaaaagagcagactt
aggagaaggagggaaagagaaataactgagatcacatcagaagaagaagaagaaatagaa
atggtgcaacatgttcacagggaattttcacctccttccagattactaaggagaagaaga
tccctttctccaacttacattgagttgatgcgccccgtatctgaattaattagaccccgt
tcacgacctcccgaggaaagtgaaagaagatccccaacaccagagagaactcgaccacgt
tcacctagtccggtttctactgaaagatcactctctcggtttgaaaggatggcaagattt
gacattttttctcgatatgagtccatgaaatctgctttgaaaacacagaaaactatggaa
aggaaatacgaagtcctaactcaacagcctttcacccttgaccatgctcctcgcatcacc
ctgagaatgcgctcacaccgtgtgccatgtggccataacaccaggttcattctgaatgtc
cagtcaaagccaacggctgacgtgaagtggtaccacaatggtattgagctccaggagagc
agtaagatacatttctcgaataccagcggggtattaacactggaaattcttgactgtcat
attgatgacagtggaacatacagggctgtatgcacaaactacaaaggagaatgttctgat
tatgcaactttagatgttactggaggagactacactacatactcttcccagcggagagat
gaagaagtaccaaggtcaattttacctgacctgacaagaacagaggcatacgcggtctca
tcgtttaaaaaagcatctgctacagaagcgagttcctcagtaagagaggtcaaatcagaa
gtgtcagcaacaagagagtcacttttatcatacgaacaccacgcttcttccgaagaaaaa
accactgcctctgaagagaaatcactagaagaaagaactgtacgtaaggcatttaagagc
actctgccagcaacgatccttacaaaaccgcggtcaatcacagtttctgaaggcgagact
gcaagattttcatgtgacgttgacggtgaaccagcaccaacaataacatgggtccgtgcg
ggtcaacctattgtttcttccaggcgcttccaaataacacggacacagtacaaatctact
tttgaaatttctttagtccagatttcagatgaaggaagttacactgttgtggtggaaaac
tctgaaggaagacaggaagcgcacttcactttgactgttcaaagaaaaagaatccctgaa
aaagcaattacgtcacctccgagaatcaaatctcctgagcctcgtgtaaagtctccagaa
ccggttaagtctcctaaacgagtgaaatctcccgaacccatcagtacccatccaaaagcc
aagtcaccacctggagacaaaacagcaccagtagagaaagtacaattaccaactgcttct
cctccaaagataaaagagcaactgaaagcagaaacccttggagataaggtgaagttatcc
tgtgcagttgaaagtagtgctttaagcgtcagggaagtggcttggtataaggatggcaaa
aaactaaaagaagaccatcatttcaagtttcattatgcagcagatggcacatacgagctc
aaaatccatgacctcacagaatctgacaaaggagaatatacttgtgaaattatgggagaa
ggaggtatttcaaaaactaacttccagtttactggccaagtatttaaaaatatccattcc
caggtacgaagcgtctctgaaactcataaattagttgagaaaggagatgaagtacttact
gtttccacccagaagaaatcatcagtggcagctgaagaaaaatcagcagttgaagaagtc
attaaaaagtcaattgttactgaagatgtcaaacaattgaaaacagaaattagagcttct
tcgactcaaatgaccatgtctgaagggcagaaagtgactttgaaagccaacattcctggt
gcctctgaagtaaaatgggtgctaaatggaatggagctaagaaattcagatgattacaga
tacggcatttctggaagtgatcacacactaactatcaagaaggctagtaataaagatgaa
ggtatactcacctgtgaaggtaaaactgatgaaggcgttattaaatgccagtacgtgctt
accttctccaaagagcgctcaaacgaaccagcatttatcatgcagccgaagtctcaaaat
gtcaatgaaggacaagatgtgttgttcacctgtgaagtttctggcgatccttctcctgaa
attgaatggcttaggaataatcaacctattgctgtttcatcacatatgagagtgactcgc
tctaaaaacacttattctcttgagattcgaaatgctgcagtgagtgacactggaaaatac
acagttaaggctaaaaattaccacgggcaatgctctgctacagcgtctttgactgtattc
cctctaattgaagaacctccaaaggaggtagtattgaagacaagtggcgacgcaagcatg
cacgaaagtttttcttctcagtcctttcaaatggctgcttctaaacaagaggcttcattc
agcagtttcagcagtagcagcatgactgaaacgaaatttgcaagcatgtctgccaaaagc
atgtcctccatgaaagaatcctttgtagagatgagctccagcagtattatggggaaatct
agtatggctcaactggaaagttcaactagtaagatgcttaaatcaggtgtgagaggagta
ccaccaaaaattgaagctctgccatctgacatcagtattgatgaaggaaaagttctcacg
ttatcttgtgctttttcgggtgaacctgctcctgaaataacatggtactgcagagggaga
aaaattaccagtcaggaccagcaaggcagattccacattgaaaccagcgaagatctaacc
accctgatcatcatggatgtccagaagaatgacggtggaatttacactctgaatttagga
aatgaatttggtaccgattctgccactgtgaatattaatattcgatcaatttag

DBGET integrated database retrieval system