KEGG   Meleagris gallopavo (turkey): 100546964Help
Entry
100546964         CDS       T01523                                 

Definition
(RefSeq) cis-aconitate decarboxylase-like
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    100546964
Enzymes [BR:mgp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     100546964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 100546964
NCBI-ProteinID: XP_010713619
Ensembl: ENSMGAG00000005495
Position
9
AA seq 493 aa AA seqDB search
MVFLTLQRSQKFLGSSRQVHKTAAHVVARSAPEETVTSSFASFIHAVRPEHLSKIVRHRS
KRMILDSIGVGLVGSTTHVFDIALKYCLELYSSVAVSNVYGKPGMKLSPTLAAFTNGVAT
HSMDFDDTWHPATHPSGAVLPALLAASQMLPPNSKPNGLDFLLAFNVGLEVQGRLMHFST
EAHNIPKRFHPPSVVGTMGSAAATAKLLSLSMTQCTHALGIAASLAGAPMANAATQAKPL
HIGNATRLGFEAALLAARGMEANPFILDDISGCSGFSAFYSIYQPRPLSTPSEHHEFLLE
KQDIAFKRFPAHLGMHWVVDAALSVRNLFINYAGSFSPSLIRTIVLKIPVSKYINRPFPN
SEHEARHSFQFNACTALLDGEVGLSSFTESSIHRQELRELLHKVVVEHPEDNVANFDKMY
GEVAVLLKSGDVLTGKCDTFYGHWRKPLSRESLLKKFRSNASHVLPEEKVETIISMVDNL
ENLSDSSHLACSL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcttaactttgcagagatctcagaagttcctgggaagctcccggcaagtgcat
aaaactgctgctcacgtggtggccaggagtgctccagaggagaccgtgaccagcagcttt
gcctccttcatccacgcagtccgacctgagcacctgtccaagatagtccgtcacagaagc
aagaggatgatccttgacagcattggcgttggccttgtgggcagcacgacccatgtgttt
gatattgctctgaagtactgcctggagctgtactcttcagttgctgtgagcaatgtctat
ggcaagcctggtatgaagctgtccccgactctggctgcgttcactaatggtgttgcgact
cactccatggactttgatgatacctggcaccctgctactcacccatcaggggctgttctt
ccagctctcctggcagcttctcagatgctacctccaaactccaaacccaatggcctggat
ttcctgctggcatttaatgtcggcttggaagtgcaaggaaggctcatgcatttctccact
gaggctcacaatattcccaaaaggttccaccctccttcagtagtcggtactatgggcagt
gctgcagccactgcaaagctgctgtctctcagcatgacccagtgtacccatgccttgggc
atcgctgcttcgcttgcaggagcacccatggcaaatgctgccacacaagccaagccattg
catattgggaatgccacccgcctgggctttgaagcagcactgctggctgcccgaggaatg
gaagctaaccctttcattctggatgatatctctggttgctctggattcagtgctttttac
agcatctatcaacccagaccactgtccacaccaagtgagcaccatgagttcctcttggag
aagcaggatattgctttcaagcgattcccagcccacctggggatgcactgggtggtggat
gctgccttgtccgttcggaacctcttcatcaactatgcagggtccttctctccctctttg
atccgtaccattgtgctgaagatcccagtgtcaaagtacatcaataggcctttccccaac
tcagaacacgaggccagacactccttccagttcaatgcctgtacagccctgttggatgga
gaagtgggcctcagctccttcacagagagcagcatccaccggcaggagctgagggaactg
ctccacaaagtggtagtggagcaccctgaagataatgtggctaactttgacaaaatgtac
ggagaggtggcagtgctcctgaagagtggggatgtcctgacaggcaaatgtgacactttt
tatgggcactggaggaagcctcttagcagggaatcactcctgaagaagtttcgatccaat
gcctctcatgtgcttccagaagaaaaggtagaaaccatcatctctatggtggacaatctg
gagaacctgtcagatagctctcatctggcctgtagcctgtga

DBGET integrated database retrieval system