KEGG   Meleagris gallopavo (turkey): 100546989Help
Entry
100546989         CDS       T01523                                 

Gene name
FBP1
Definition
(RefSeq) fructose-bisphosphatase 1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00010  Glycolysis / Gluconeogenesis
mgp00030  Pentose phosphate pathway
mgp00051  Fructose and mannose metabolism
mgp01100  Metabolic pathways
mgp01200  Carbon metabolism
mgp04910  Insulin signaling pathway
Module
mgp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100546989 (FBP1)
   00030 Pentose phosphate pathway
    100546989 (FBP1)
   00051 Fructose and mannose metabolism
    100546989 (FBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100546989 (FBP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100546989 (FBP1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     100546989 (FBP1)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100546989 (FBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P SRAP
Motif
Other DBs
NCBI-GeneID: 100546989
NCBI-ProteinID: XP_019466097
Position
Z
AA seq 255 aa AA seqDB search
MLKSSFSTCVIVSEENKDAVIVEADRRGKYIVCIDPLDGSSNIDCLVSIGTIFGIYRKVS
PDEPTGKDALQPGRNLVAAGYALYGSATMLVLATSAGGVNCFMLDPAIGEFILVDRDVKI
KKKGSIYSLNEGYAKYFDSAVTEYLRKKKFPEDGSSPYGGRYIGSMVADVHRTLVYGGIF
LYPANSKSPKGKLRLLYECNPMAFVIEKAGGIATTGHQSILDIVPEDIHQRVPVVLGSPD
DVKEYLEIVKKHAAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtcatctttcagcacatgcgttattgtgtcagaagaaaacaaggatgctgta
atagtggaagctgacagaaggggtaaatacatagtctgcatagaccctctggatggatca
tctaacattgactgtcttgtttccattgggaccatctttggcatctatagaaaggtatcc
cctgatgaacctactgggaaagatgctttacagccagggcgtaatcttgtggctgcgggt
tatgctctctatgggagtgccacaatgctggtactggctacttctgctggaggtgtcaac
tgttttatgcttgatccggcaattggagaattcattttggttgatagggatgtgaaaatc
aaaaagaaggggagtatctacagtctcaatgaaggctatgccaaatactttgattctgca
gtcactgaatatctcaggaagaagaaatttcctgaggatggcagttcaccatatggtgga
aggtacataggatctatggtggctgatgtacatcgcacgctggtgtatggaggaattttt
ctgtatcctgctaactccaaaagtcctaaagggaagctgagactgctctatgaatgcaat
cccatggcttttgttattgagaaagctgggggaatagcaacaacagggcatcagtcaata
ctagatatagtgcctgaggatatccaccaaagagtgcctgttgtcttgggatctcctgat
gatgtgaaggagtacctggaaattgtcaaaaaacatgcagctaaatga

DBGET integrated database retrieval system