KEGG   Meleagris gallopavo (turkey): 100547044
Entry
100547044         CDS       T01523                                 
Symbol
LYZ
Name
(RefSeq) lysozyme C
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100547044 (LYZ)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100547044 (LYZ)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100547044 (LYZ)
SSDB
Motif
Pfam: Lys SLT_3 SLT
Other DBs
NCBI-GeneID: 100547044
NCBI-ProteinID: XP_003202118
Ensembl: ENSMGAG00000010559
UniProt: P00703
Structure
Position
1:34890259..34893996
AA seq 147 aa
MRSLLILVLCFLPLAALGKVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHA
TNRNTDGSTDYGILQINSRWWCNDGRTPGSKNLCNIPCSALLSSDITASVNCAKKIASGG
NGMNAWVAWRNRCKGTDVHAWIRGCRL
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaggtctttgctaatcttggtgctttgcttcctgcccctggctgctctggggaaagtc
tatggacgatgtgagctggcagcagctatgaagcgtctgggacttgataactatcgggga
tacagcctgggaaactgggtgtgtgccgcaaaattcgagagtaacttcaacacacatgct
acaaaccgtaacaccgatgggagtaccgactacggaatcctacagatcaacagccgctgg
tggtgcaatgatggcaggaccccaggctccaagaacctgtgcaatatcccatgttcagca
ctgttgagctcagacataacagcgagcgtgaactgcgcgaagaagatcgccagcggtgga
aacggcatgaacgcgtgggtcgcctggcgcaaccgctgcaagggcaccgacgtccacgcg
tggatcagaggctgccggctgtga

DBGET integrated database retrieval system