KEGG   Meleagris gallopavo (turkey): 100547300
Entry
100547300         CDS       T01523                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mgp01002]
    100547300 (ERAP1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100547300 (ERAP1)
Peptidases and inhibitors [BR:mgp01002]
 Metallo peptidases
  Family M1
   100547300 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N BLOC1_2
Other DBs
NCBI-GeneID: 100547300
NCBI-ProteinID: XP_010724343
Position
Z
AA seq 842 aa
MAVPRWEVVVLALASVAWCAGDAQGGGGSAQFPWDEVRLPKHVVPLHYRLLIHPNLTTLT
FTGTVDIDVAVAQPTKAVVLHGKRLRVTGAAIEAGAGSTCAVRDVRLLQNPPREQLALLV
KSVNIASQLVEDHFDTSVKMSTYLVAFIVSDFKSISKVTNHGVKISVYTVPEKINQAHYA
LDAAVKLLDFYEDYFSIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLYDPEKSSAS
SRLWITMVVAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMELLSVNVTHPELRVEDYFLR
RCFDAMEVDALNSSHPVSTPVEDPAQILEMFDEVSYEKGSCILNMLRDFLTADVFKAGLV
QYLRKYSYQNTKNEDLWDSLTNICPAVGIEKSELQGDGFCRRNQQSSSNAHWTKETIDVK
AMMDTWTLQKGFPLVTVTVSGKNVHLQQEHYRKGVDSLSPTENGYLWHIPLTYITSKSHS
VQRFLMRTKTDVIILPEEVEWVKFNVDMNGYYIVHYENDGWDRLINLLRENHTMISSNDR
ASLINNIFQLVRVKRLSISKAFDLTLYMKRETQIMPVLQGMNELVPIYKLMERRDMDDTE
KQLKDYIVNLFKDLIDKQLWSDEGSVSERMLRQSLLMFACVRRYQPCVDKAEEYFSKWQK
SNGTLRLPADVKTAVYIVGAQTSEGWDFLLSKYQHHSFSVDKDKIASALSLTRNKDKLQW
LMEEGLRGDIIKTQDFPYIIVSVARNPSGYHLAWTFLRENWEKLIEKFELGSSSIAGIVT
GVTNQYSTRPQLAQVKEFFSSLEEKSAQLRCIQQAIETIEDNIEWMDRYSEEIKMWLQKN
QP
NT seq 2529 nt   +upstreamnt  +downstreamnt
atggcagtgccgcgctgggaggtggtggtgctggcgctggcgagcgtggcgtggtgtgct
ggtgatgcccagggcggtggcggcagcgcgcagtttccctgggacgaggtgaggctgccc
aagcacgtcgtcccgctgcactaccgccttctcatccatcccaacctcaccacgctcacc
ttcaccggcaccgtggacatcgacgtcgcggtcgcgcagccgacgaaggcggtcgtccta
cacggcaaacgcctgcgcgtcaccggggctgccatcgaggcgggggccgggagcacctgc
gcggtgcgggacgtgaggctgctgcagaacccgccccgcgagcagctggcgctgctggtg
aagtccgtgaatatagcttcacagcttgttgaggaccattttgataccagtgtcaagatg
agcacttaccttgtggcctttatcgtttcggattttaagtccatcagcaaagtaaccaat
catggagttaagatttctgtatacacagtaccagaaaagatcaaccaggctcattatgca
ctggatgcagcagtaaaacttctagacttttatgaggactacttcagcattccctacccc
ttaccaaaacaagatttagcagctattcctgattttcagtctggtgctatggaaaactgg
gggttgaccacataccgggaatctgcgttgctgtatgatcctgaaaagtcctcagcatcc
tctaggctttggattactatggtagtagcccatgagctggctcaccagtggtttggcaac
ctagttaccatggaatggtggaatgatctgtggttaaatgaagggtttgcaaaatttatg
gagctcctgtcggtaaacgttacccatccagaactgagagttgaagattatttcttaaga
agatgctttgatgctatggaagtggatgcgttgaattcatcccatcctgtgtctactccc
gtggaggatccagctcaaattttagaaatgtttgatgaagtttcgtacgagaagggatca
tgtatattaaatatgttgagggacttcctgactgcagatgtgtttaaggctggacttgtg
cagtacctacggaaatacagttatcagaatactaagaatgaagatttgtgggacagtttg
acaaatatttgtcccgcagtaggtattgagaaaagtgaactacagggtgatggcttttgc
agaagaaatcaacagtcatcttcaaatgcacactggaccaaagagactatagatgtgaag
gcaatgatggacacttggacactgcaaaaaggttttcctctggtaactgtcactgtgagt
ggaaagaacgtccacctgcagcaggagcactacaggaaaggagtagattctctttcacct
acagaaaatgggtacttgtggcacattccactaacctacattaccagcaaatctcacagt
gttcaaagatttttgatgagaaccaaaacagatgtcattatccttccagaagaagttgaa
tgggttaaattcaatgtggacatgaatggttattacattgtgcactatgaaaatgacgga
tgggatcgtctgatcaaccttttaagagagaatcatacaatgattagcagcaatgacaga
gcaagtcttattaacaatatattccagcttgtgagagtaaaaagactgtcaatttctaaa
gcttttgatttaactttatacatgaaacgggaaacacagatcatgcccgtactccaaggt
atgaatgagctggttcctatatacaagctcatggagcggagagatatggatgacacagaa
aaacagctgaaggactatatagtcaatctatttaaggacctaattgacaagcagctttgg
agtgatgaaggttcagtgtctgagagaatgcttcggcagtccctgctgatgtttgcatgt
gtgcgcaggtaccagccctgtgtggacaaagcagaagagtatttttcaaaatggcagaaa
tccaatggaaccttaaggctgccagcagatgtgaagacagcagtatatattgttggagca
caaacatctgaaggttgggatttcctccttagtaaataccagcaccactctttcagtgta
gacaaagataaaattgcatcagctctcagcctcaccaggaataaggacaaacttcagtgg
ctaatggaggaaggtctgcgtggtgacatcataaaaactcaggattttccatacattatt
gtgtctgttgccagaaatccatctggctatcatctcgcttggaccttcttaagggagaac
tgggagaaacttatcgaaaaatttgaactcggttcatcatccatagcaggcattgtcact
ggagtgacaaatcagtactcaacaaggccacagcttgcacaggtaaaagaattcttcagt
tctctggaggaaaaaagtgcacagcttcgttgtatccagcaagccattgaaaccattgag
gacaacatagaatggatggatagatattctgaggaaataaaaatgtggctgcaaaagaac
cagccataa

DBGET integrated database retrieval system