KEGG   Meleagris gallopavo (turkey): 100547365Help
Entry
100547365         CDS       T01523                                 

Gene name
GUCY1B3
Definition
(RefSeq) guanylate cyclase 1 soluble subunit beta
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00230  Purine metabolism
mgp01100  Metabolic pathways
mgp04270  Vascular smooth muscle contraction
mgp04540  Gap junction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100547365 (GUCY1B3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100547365 (GUCY1B3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100547365 (GUCY1B3)
Enzymes [BR:mgp01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100547365 (GUCY1B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 100547365
NCBI-ProteinID: XP_010707736
Ensembl: ENSMGAG00000001498
Position
4
AA seq 551 aa AA seqDB search
MFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKG
KGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRSEECDHIQFLIEEKESKE
EDYYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNC
NLLSVFSLVRPHIDISFHGILSHINTVFVLRTKEGLLDVEKLECEDELTGTEISCLRLKG
QMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQE
LEILTDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIV
GFNAFCSKHASGEGAMKIVNLLNDLYTRFDILTDSRRNPFVYKVETVGDKYMTVSGLPEP
CIHHARSICHLALDMMEIAGQVQVDGEPVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVN
LTSRTETTGEKGKINVSEYTYRCLMTPENSDPQFHLEYRGPVSMKGKKEPMQVWFLSRKS
TETEETKQDTF
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagatgttttttgtgttttgtcaagaatctggctatgatacaattctgcgt
gttctgggctcaaatgttagagaatttttgcagaacctggatgctctgcatgaccatctt
gctactatttacccaggtatgcgagccccttccttcagatgcactgatgcggagaagggg
aaaggactcattctgcattactattcagaaagggaaggtctacaggacattgtcattgga
atcatcaaaacagtagctcagcagatccatggtacagaaatagatatgaaggttattcaa
cagcggagtgaggaatgtgaccacattcaatttttaattgaagagaaagaatctaaagaa
gaggactactatgaggaccttgacagatttgaagaaaatggtacccaagagtctcgcatc
agtccatatactttctgcaaggcttttcctttccacataatatttgacagagatctggtg
gtcacacagtgtggcaatgcaatatacagagtccttccacagctgcaaccaggaaattgc
aatcttttgtcagtgttctccttggtccggcctcatattgatattagtttccatgggatc
ctctcacatatcaatacagtctttgtactgaggaccaaggaggggctgttggatgtagag
aagctggagtgtgaagatgagttgactggtacagaaatcagttgcttacgcctgaaaggg
caaatgatctacttgcctgaagcagacagcattctatttctttgttcaccgagtgttatg
aacttggatgatttaaccagaagagggttatatctgagtgatattccattgcatgatgct
acccgtgatctggttcttttgggagagcagttcagagaggaatataaactgactcaagag
cttgagatcctcactgacagactgcagcacacactacgtgcactcgaagatgaaaagaaa
aagacagacacattactgtactccgttctaccaccatcggtggcaaatgagctgagacac
aagcgtcctgttccagctaagcgatacgacaacgtcaccattctcttcagtggcattgtt
ggattcaatgccttctgtagtaagcatgcctctggagagggagctatgaagattgttaat
cttttaaatgatctttacacgagatttgatattctaactgattcacgaaggaatccattt
gtttacaaggtggaaacagttggggacaagtatatgactgtgagtggtctaccagagcct
tgcattcatcatgcacgatctatctgccacctagcattggatatgatggaaatagcaggc
caagttcaagttgatggggagcctgtacagataacaataggaatccatactggtgaggta
gtcacaggtgtcataggccaaaggatgccacgttactgcctgtttggaaatactgtcaat
ttaacaagcaggacagaaactactggagaaaagggaaagatcaatgtctctgagtatacg
tacagatgtcttatgacaccagaaaattcagatcctcagttccacctggaatacaggggt
ccagtttctatgaagggtaaaaaagaaccaatgcaggtttggtttttgtcccgaaagagt
acagagacagaggaaacaaagcaagatactttctga

DBGET integrated database retrieval system