KEGG   Meleagris gallopavo (turkey): 100548554Help
Entry
100548554         CDS       T01523                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04020  Calcium signaling pathway
mgp04114  Oocyte meiosis
mgp04140  Autophagy - animal
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04270  Vascular smooth muscle contraction
mgp04310  Wnt signaling pathway
mgp04340  Hedgehog signaling pathway
mgp04371  Apelin signaling pathway
mgp04530  Tight junction
mgp04540  Gap junction
mgp04910  Insulin signaling pathway
mgp04912  GnRH signaling pathway
mgp04914  Progesterone-mediated oocyte maturation
mgp04916  Melanogenesis
Module
mgp_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100548554 (PRKACB)
   04310 Wnt signaling pathway
    100548554 (PRKACB)
   04340 Hedgehog signaling pathway
    100548554 (PRKACB)
   04371 Apelin signaling pathway
    100548554 (PRKACB)
   04020 Calcium signaling pathway
    100548554 (PRKACB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100548554 (PRKACB)
  Cell growth and death
   04114 Oocyte meiosis
    100548554 (PRKACB)
  Cellular community - eukaryotes
   04530 Tight junction
    100548554 (PRKACB)
   04540 Gap junction
    100548554 (PRKACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100548554 (PRKACB)
   04912 GnRH signaling pathway
    100548554 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    100548554 (PRKACB)
   04916 Melanogenesis
    100548554 (PRKACB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100548554 (PRKACB)
   04270 Vascular smooth muscle contraction
    100548554 (PRKACB)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100548554 (PRKACB)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: AGC group
  PKA family
   100548554 (PRKACB)
Messenger RNA biogenesis [BR:mgp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100548554 (PRKACB)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100548554 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Pkinase_C
Motif
Other DBs
NCBI-GeneID: 100548554
NCBI-ProteinID: XP_019474224
Ensembl: ENSMGAG00000006417
Position
10
AA seq 356 aa AA seqDB search
MFLQTLWGPIETFVKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVK
HKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVME
YVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQ
VTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD
QPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTD
WIAIYQRKVEAPFIPKCRGPGDTSNFDDYEEEDIRASLTENVQKNLLIFSRSRRTR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgcaaaccctttggggacctatagagacctttgtgaaagagttcctagccaaa
gccaaagaagactttttaagaaaatgggaaagcccacctcagaatactgctggcctagat
gattttgagaggcaaaaaactcttggaacaggatcatttgggagagttatgatggtgaag
cataaagccacagaacagtattatgccatgaagatactggacaaacaaaaggttgtcaag
ctgaagcagatagaacacacactgaatgaaaagagaatattacaagcagtgaactttcct
ttccttgtaaaactggagtattcttttaaggacaattctaatttatacatggtaatggag
tatgttcctggtggtgaaatgttctcacatctaagaagaatcggaaggttcagtgaacca
cacgcacggttttacgcagctcagatagtgctaacatttgagtacctccattcattagac
ctcatctacagagatctaaagcctgaaaatcttttaattgatcagcaaggatacatccag
gtcacggactttggctttgcaaaaagagtaaaaggaagaacttggacattatgtgggact
ccagaatacctggcacctgaaataattctcagcaagggttacaacaaggcagtggattgg
tgggcattaggagtgttaatctatgaaatggcagctggatatcccccattctttgcagat
caacccattcaaatttatgagaagattgtgtctggcaaggtaaggttcccatcacacttc
agttcagatctaaaggatcttctaagaaatttactccaggtagatttgaccaaacgatat
ggaaatctcaagaatggtgtaaatgacataaagaaccacaagtggtttgcgactacagat
tggattgccatttatcagagaaaggtagaagctccattcataccaaagtgcagaggccct
ggagataccagcaactttgatgactatgaagaagaagatattcgtgcgtctctaacagaa
aatgtgcaaaagaatttgctgatttttagtaggagtaggaggacaagatga

DBGET integrated database retrieval system