KEGG   Meleagris gallopavo (turkey): 100548569Help
Entry
100548569         CDS       T01523                                 

Gene name
GRIK4
Definition
(RefSeq) glutamate ionotropic receptor kainate type subunit 4
  KO
K05204  glutamate receptor, ionotropic kainate 4
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100548569 (GRIK4)
Ion channels [BR:mgp04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100548569 (GRIK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 100548569
NCBI-ProteinID: XP_019478574
Ensembl: ENSMGAG00000002074
Position
26
AA seq 959 aa AA seqDB search
MPRVWAPLVLLLLWLMRTAASPHALRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVGVLGPSSSPASSSIISNICGEKEVPHFR
VAPEEFLKLQLQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDSRDPTPLLKEIRDDKTATIIVHANASMSHTILQKAAELGMASAY
YTYIFTNLEFSLQRLDSQLDDRVNILGFSIFNQSHAFFQEFVQSLNQSWQENCDHAPFTG
PALSSALLFDAVYAVVSAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQHTHSGFRQIGHWHVSEGLSMDNRIFSSNISDSLFNTTLIV
TTILENPYLMLKWNHQELEGNDRYEGFCVDMLKELAEILRFNYKIHLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCSQGRCNLLINQYSLGNSLWFP
VGGFMQQGSTIAPQALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTTIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQVGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWSLRHSEQSEVS
VCQEMVTELRNIILCKDSFHPRRRRGGXIRTRPAIPEERRARSTTTLSNGKLCSGGEPDP
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPAPGSPAQSEESLEWEKTTNSSEPE
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgtatgggcgcctctggtgctccttctgctgtggctgatgaggacggctgcc
agcccacacgccctgcgcatcgccgccatcctggatgaccccatggagtgcagccggggg
gagcggctctccatcaccctggccaagaaccgcatcaaccgcgcgcccgagcgcctgggg
aaggccaaggtggaggtggacatcttcgagctgctgagggacagcgagtatgagacggca
gaaaccatgtgccagatccttcccaaaggggtggtgggcgtcctggggccttcctccagc
ccggcctccagttccattatcagcaatatctgtggggagaaagaggttcctcacttcaga
gtggcaccggaagagttcctgaagctgcagctccagcgcttcaccaccctcaacctccat
cccagcaacaccgacatcagtgtggccgtggcaggaatcctcaacttctttaactgcacc
actgcctgcctcatctgtgccaaagctgaatgccttttaaacctagagaagttgcttcgg
cagttcctcatttctaaggacacgctctcagtccggatgctggatgacagccgggaccct
acgcctctcctcaaagagatcagagatgacaaaacagccaccatcattgtccatgccaac
gcctcaatgtcccacaccatcctgcagaaggcagccgagctgggaatggcatctgcctat
tacacatatatcttcactaatctggagttttcactccagcgcctggacagtcagttggat
gatcgagtcaacatcctgggattttccattttcaaccagtctcatgcttttttccaagag
tttgtccagagcctcaaccagtcctggcaggagaactgcgatcatgctccttttactgga
ccagcactctcctctgccctgctgtttgatgccgtgtacgccgtggtgagcgccgtgcag
gagctgaaccgcagccaggagatcggcgtgaagccgctgtcctgtggctctgcccagatc
tggcagcacggcaccagcctgatgaactacctgcgcatggtagaattggaaggtctcacc
ggccacatcgaattcaacagcaaaggccagcgttccaactatgccctgaaaatcctgcag
cacacacacagcggcttccggcagatcggccactggcacgtttctgaaggactcagcatg
gacaacaggatattctcctccaacatatctgacagcctgttcaataccacactcatcgtc
accaccatcctggaaaacccttacttaatgctgaagtggaaccatcaggagctggaagga
aatgaccgctacgagggcttctgtgtggacatgttgaaggagctggcagagatcctacgc
ttcaactataagatccacctggttggcgatggtgtctatggagtccctgaggcaaacggc
acgtggacagggatggtcggggagctgattgctcggaaagccgacctggcagtggcgggg
ctgacgattactgcggagcgggagaaggtgattgatttctctaagccattcatgactttg
ggaattagcattctctaccgagttcatatgggtcgcaagcctggctacttctccttcctg
gaccccttttcccccggcgtgtggctcttcatgctgctcgcctacctggccgtcagctgc
gtcctcttcttggtggctcgcttgacgccctatgagtggtacagcccccacccctgctca
caaggcaggtgcaaccttctcatcaaccagtactcactgggcaacagcctgtggtttcct
gtcggggggttcatgcagcaaggctccaccatcgccccccaggcgctctccacgcgctgc
gtcagtggagtctggtgggccttcaccttgatcatcatctcctcctacacggccaacctg
gctgccttcctcacggtgcagcgcatggacgtccccattgagtctgtagatgacctggca
gaccagaccaccatcgagtatggcaccattcatggcggctccagcatgaccttcttccaa
aactcccgctaccagacgtaccagcggatgtggaactacatgtactccaagcagcccagt
gtctttgtgaagagcacggaggaagggatcgcgcgtgtgctgaactccaattacgccttc
ctgctggagtccaccatgaacgagtattatcgtcagcgcaattgcaacctcacgcaggtc
gggggccttctggacaccaagggctacgggattggcatgcccgtcggctccgtgttccgc
gatgagttcgacctggccatcctccagctgcaggagaacaaccggctggaaatcctgaag
cgaaagtggtgggaaggaggcaagtgtcccaaggaggaggaccaccgggccaaaggcctg
ggaatggagaacattggtggaatcttcgtggttctcatctgtggcttaatcgtagcgatt
tttatggcaatgctggaatttttgtggagccttcggcactctgagcagtcagaggtgtcg
gtgtgccaagagatggtgacagagctgcgcaacatcatcctctgcaaggacagtttccac
ccccgtcggaggcgagggggantgatacggactcgccccgctatccccgaggagcgccga
gcccgcagcacgaccacgctcagcaacgggaagctgtgcagtgggggagagccagacccc
ctggcacaaagactggcacaagaagctgccctggtcgcccgaggctgcacgcacatccgc
gtctgccctgagtgccgcaggttccaggggcttcgggcacggccggctccgggctcacct
gcacagagcgaggagagcttggagtgggagaagaccaccaacagcagcgagcccgagtaa

DBGET integrated database retrieval system