KEGG   Meleagris gallopavo (turkey): 100548598
Entry
100548598         CDS       T01523                                 

Gene name
LGALS3
Definition
(RefSeq) galectin-3 isoform X1
  KO
K06831  galectin-3
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100548598 (LGALS3)
   04091 Lectins [BR:mgp04091]
    100548598 (LGALS3)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100548598 (LGALS3)
Lectins [BR:mgp04091]
 S-type lectins (Galectins)
  100548598 (LGALS3)
SSDB
Motif
Pfam: Gal-bind_lectin
Other DBs
NCBI-GeneID: 100548598
NCBI-ProteinID: XP_003206858
Ensembl: ENSMGAG00000013646
Position
5
AA seq 232 aa
MSDGFSLSDALPAHNPGAPPPQGWNRPPGPGAFPAYPGYPGAYPGAPGPHHGPPGPHHGP
PGPHHGPPGPFPGGPPGPYPGGPTAPYSEASAAPLKVPYDLPLPAGLMPRMLITITGTVN
PNPNRFSLDFKRGQDIAFHFNPRFKEDHKRVIVCNSMFHNNWGKEERTAPRFPFEPGTPF
KLQVLCEGDHFKVAVNDAHLLQFNFREKKLNEITKLCIAGDITLTSVLTSMI
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtcggacggtttctctctctccgacgccttgcctgctcacaaccctggtgccccccca
ccccagggctggaaccggcccccaggacctggagccttcccggcataccctggataccca
ggtgcctatcctggtgcaccaggaccgcatcatggaccgccagggccgcatcatggaccg
ccagggccgcatcatggaccacccggaccattccctggaggaccaccagggccgtatcct
ggaggaccaactgcaccgtactctgaagcttcagctgctccactgaaagtcccctacgat
ctgcccctgccagcaggactcatgcctcggatgctcataaccatcacggggactgtgaac
ccaaatcccaacaggttttcactggatttcaagagggggcaagacattgccttccacttt
aacccccgtttcaaggaagaccacaaaagggtcatcgtctgtaattcaatgttccacaat
aactggggaaaagaggagagaacagctcctagatttccctttgaacctggaacccccttc
aagctccaggtgctctgtgagggggatcacttcaaggtagcagtgaatgatgctcacctg
ctgcagttcaacttccgtgagaagaagctgaatgagatcaccaagctctgcattgctggg
gacatcactctcaccagcgttttgacctccatgatttaa

DBGET integrated database retrieval system