KEGG   Meleagris gallopavo (turkey): 100548640
Entry
100548640         CDS       T01523                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mgp03000]
    100548640 (AHRR)
Transcription factors [BR:mgp03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100548640 (AHRR)
SSDB
Motif
Pfam: PAS_11 PAS Herpes_U5
Other DBs
NCBI-GeneID: 100548640
NCBI-ProteinID: XP_019469853
Position
3
AA seq 619 aa
MQLERPSGTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMSGQQLQTETGEEYILSKLF
KAQENDSTTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGKLKFLFGQRKKSSSGAVLP
PQLSLFCIVVPLLLPSVTEMKMKSLLVKTKHKADEAAVNTNSSSKGNSGLCEAAELYGRN
SHHEGATFANVLQITENQFKAKNNGENGISLVKVQTNEDHWVWVQANTQLLYRSGCSEYV
VAQQQMLKEEDEQLKIPNSFASLKGSLEGLSYNSAIETLGQLKHLNWTAVKNEQDNVKVK
FEPHTNGECFVQEESLSSNTPILGIQNNCTTNSSWTFRNSSSCSINQRMNACSNRRAGSF
YNRDQSFLNLASTCPSHWGSAENCQSYSGLQQRAVENYTTDHLKLQRSLISSESLYDTSF
PLDMPIKTEYDSDSENIADNYPMPQNRAWLDENGAMRKQLFSYPNRVHLKAEPDLCQQAS
PCQKPRHCLYTPHNWQCIVANHPSNLNLNRSCKGLRNREVAPFCPQNSSACLESLPDLPH
TEGYGQFYSPAPGEKEQSNEVFKMPCEFKNPCLVQAIKREPLDSPPLSNIGQNRAHMSFP
ENTIAGPVPHKATECTFLQ
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgcagttggaaaggccctccggaactgatgtaatgcaccaaaacatatatgattacatt
catgttgacgatcgccaggatttctgtagacaactgcactgggccatgaatccacctcag
atgtctggacagcaactacagacagaaacaggagaagaatatattctcagtaaattgttt
aaagcacaagagaatgacagcacaacaacagattattcttccttcttaactcgttgtttc
atctgtcgagttcgctgcttgttggacagtacttctggcttccttacaatgcagtttcaa
ggcaaactgaagtttctttttggacaaaggaagaagtcctcatcaggagcagtattacca
cctcagctgtctttattctgcatagtggtaccactacttctcccttctgtgacagagatg
aagatgaaaagcctacttgtgaaaacaaaacacaaagctgatgaggcagcagtgaataca
aactccagttccaaaggtaattcaggtctgtgtgaagcagcagaattatatggaagaaat
agtcatcatgaaggtgcaacttttgctaatgtattacagattactgaaaaccaattcaaa
gcgaagaataatggagaaaatggcatttctcttgtcaaagtacaaacaaatgaagatcac
tgggtctgggttcaagctaacactcaacttctgtatcgaagtggttgttcagaatatgtt
gttgcccaacagcaaatgctaaaggaagaagatgaacaactgaagataccgaacagtttt
gccagtttgaagggaagcctggaaggactttcctacaacagtgccattgaaactctgggc
caattgaagcatctcaactggacagcagtaaaaaatgagcaagataatgtaaaagtgaag
tttgagcctcatacaaatggtgagtgttttgtgcaggaggaatctctcagttctaataca
ccaattttaggcattcaaaacaactgcaccacaaacagtagctggactttcagaaactca
agctcttgttctataaatcagcgaatgaatgcgtgttcaaaccgaagagctggatcattc
tacaacagagaccaaagtttcttaaatttagcatcaacttgtccttcccactggggtagt
gcagaaaattgtcagtcttactcaggcttacaacaacgtgcagtggagaactatactaca
gatcacctgaaactgcagagatcgttaatatcctcggagtctctctatgatacatcgttt
cccttggatatgcctatcaaaacagaatatgattctgattctgaaaacattgctgataac
tacccgatgccacaaaacagagcctggctggatgagaacggcgccatgaggaagcagttg
ttcagctatcccaatagggtgcaccttaaagcagaaccggacctctgtcagcaagcttca
ccttgccagaagccaaggcactgcctttacacaccacataactggcagtgcattgtagca
aatcatcccagcaacctcaatctgaacagatcttgcaagggtttgcgtaacagagaggtg
gccccgttttgcccccagaactcctccgcctgcttggaaagcctgcccgacctgccgcac
accgagggctatggccagttctacagccctgctccaggggagaaggagcagagtaatgag
gtgtttaaaatgccatgtgaatttaaaaacccttgcttggttcaagcaatcaagcgtgag
ccgctggattccccaccgttgtccaacattggacagaacagagcacacatgagcttccct
gaaaacacaatcgcaggtcctgtgcctcataaagccactgaatgtacattcttacaatag

DBGET integrated database retrieval system