KEGG   Meleagris gallopavo (turkey): 100548856Help
Entry
100548856         CDS       T01523                                 

Gene name
SEPT7
Definition
(RefSeq) septin 7
  KO
K16944  septin 7
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100548856 (SEPT7)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mgp04812]
    100548856 (SEPT7)
   04147 Exosome [BR:mgp04147]
    100548856 (SEPT7)
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    100548856 (SEPT7)
Cytoskeleton proteins [BR:mgp04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     100548856 (SEPT7)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100548856 (SEPT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 ABC_tran AAA_16 Ras AAA_22 AAA_7 FeoB_N Roc AAA_29 Gtr1_RagA LMBR1
Motif
Other DBs
NCBI-GeneID: 100548856
NCBI-ProteinID: XP_019472209
Position
6
AA seq 532 aa AA seqDB search
MQERSGWDRYRLAARRRKEKKKKKRGRMRTDARDEPAARRFPSPCPAPAASRLRAAALPL
GLGLSEASGARRVSPVTPPCAVAVGAGGLGKAALLVSTRCSRLPKERLVAQQKNLEGYVG
FANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTELYSPEYPGPSHRIKKTVQ
VEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQ
MPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKNRIM
KEIQEHKIKIYEFPETDDEEENKIVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVA
EVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLT
KFDTVEGMSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQ
MKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagaggagcgggtgggaccgataccgcctcgccgcgaggaggaggaaggagaag
aagaagaagaagaggggccgcatgcggacggatgcgcgggacgagcccgctgcccgccgc
ttcccctcgccctgcccggctcccgccgcctctcggctccgtgcggccgccctcccgctg
gggctcgggctgagcgaggcctccggagcccgccgggtctcccccgtaacgccgccctgc
gccgtggcggtgggagcgggcggcctggggaaggcggccctgctcgtttcgacgcggtgc
tctcggcttccgaaggagcggttggtagctcaacagaagaaccttgaaggatatgtgggg
tttgcaaatcttccaaatcaagtttaccggaagtctgtgaagagaggatttgagttcaca
ctcatggtagtaggtgaatctggactgggaaaatcaacattaatcaactcattattctta
acagaattatattccccggagtatccaggtccttcacacagaattaaaaagactgtacag
gtggagcagtcaaaagttttaatcaaagaaggtggtgttcagttactacttacaatagtt
gacacaccaggatttggagatgctgtggataatagtaattgttggcagcctgttattgac
tacattgacagtaaatttgaggactacctgaatgcagaatctcgtgtcaacagacgtcag
atgccagataatagagttcagtgctgtttatacttcattgctccttcaggacatggactt
aagcctttggatatagagtttatgaagcgcctgcatgaaaaagtgaatatcattccactt
attgccaaagcagacacacttacacctgaggaatgccaacagtttaaaaacagaataatg
aaagaaatccaagaacacaaaattaaaatatatgaatttccagaaacagatgatgaagaa
gaaaacaagattgttaaaaagataaaggaccgtttacctctggctgtggtaggtagtaat
acaatcattgaagtcaatggcaagagagttagaggaagacagtacccatggggtgttgca
gaagttgaaaatggggaacactgtgacttcacaattctgaggaacatgttgataagaact
catatgcaggacctgaaggatgtcactaacaatgtacattatgagaactacagaagcaga
aaactggcagctgttacatacaacggtgttgacaacaataaaaataaagggcagctaaca
aaatttgacacagttgaaggcatgagcccattggcacagatggaggaggagaggagagag
catgtagccaaaatgaaaaaaatggagatggaaatggaacaggtgtttgagatgaaagtc
aaagaaaaagtacagaaactgaaggactctgaagctgagctgcagcgacgccacgagcaa
atgaaaaagaatttggaggctcaacacaaagaattagaggaaaagcgtcgccagtttgag
gatgagaaagcaaactgggaagctcagcaacgtattttggaacaacagaattcctccaga
accttggaaaagaataagaagaaagggaagatattttaa

DBGET integrated database retrieval system