KEGG   Meleagris gallopavo (turkey): 100549431Help
Entry
100549431         CDS       T01523                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mgp01002]
    100549431 (ABHD6)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100549431 (ABHD6)
Peptidases [BR:mgp01002]
 Serine Peptidases
  Family S33
   100549431 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Thioesterase DUF1057 DLH Esterase C9orf72-like
Motif
Other DBs
NCBI-GeneID: 100549431
NCBI-ProteinID: XP_003210141
Ensembl: ENSMGAG00000006715
UniProt: G1N4I8
Position
14
AA seq 338 aa AA seqDB search
MDLDVLNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRALGMQVKYVNYDDSYQ
FCYSYRGRPGYRPSILMLHGFSGHKDMWLSIVKFLPKNLHLVCVDLPGHEGTTRSALDDY
SIMGQAKRIHQFVECIKLNKRPFHLVGTSMGGNVAGVYAAQYPEDVCSLSLICPAGLPSF
TDSKFVKMLRELKESERTDRIPLIPSTPEEMADMLKLCSYVRFKVPQQILQGLVDVRIPH
NDFYRKLFLEIVDEKSRHSLHENMNKIKAPTQVIWGKQDQVLDVSGADILASAIPDCHVS
ILENCGHSVVVERPRKTANLILEFLAMLHSTGNSKKQA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgatgtgctcaacatgttcgtcatcgctggcggcaccctggccatccccatc
ctggcctttgtggcctccttcctgctgtggccctctgcgctcatccgcatctactactgg
tactggcgtcgagccctgggcatgcaggtcaaatacgtaaactatgacgacagctatcag
ttttgttattcctatagaggaagacctgggtaccggccatctatcctgatgctgcatggc
ttctcaggccacaaagacatgtggctgtccatagtcaagttcctccccaagaacctgcac
ttggtgtgcgttgacttgcctgggcatgagggcacaacccgctcagccttggatgattac
tccattatgggacaagcaaagaggatccaccagtttgtggagtgcatcaagctgaacaag
aggcccttccacctcgtcggcacctccatgggtgggaacgttgccggggtttatgccgcg
cagtacccagaggatgtgtgcagcctgtctctgatttgtcctgcagggttgccgagcttc
accgatagcaagtttgtcaagatgctccgggagctgaaggagtccgagcgcaccgacagg
atcccactgattccctccacacccgaggagatggccgacatgctgaaactctgttcctat
gttcgattcaaggtgccacagcagatccttcagggcctggtggacgtccgcatcccacac
aacgatttctaccgaaaattgtttttagaaattgtggatgagaagtcccggcactctctc
catgagaacatgaacaagatcaaagcaccgacgcaggtcatctggggaaagcaggaccag
gtcctggatgtttctggtgctgacatcttagcaagtgccatcccggactgccacgtgtcc
atcctggagaactgtggccactcggtggtggtggagcggccacgcaagacagcaaatctc
atcctggagttcctggcaatgctgcacagcacaggcaacagcaagaagcaggcgtga

DBGET integrated database retrieval system