KEGG   Meleagris gallopavo (turkey): 100549777Help
Entry
100549777         CDS       T01523                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00010  Glycolysis / Gluconeogenesis
mgp00030  Pentose phosphate pathway
mgp00051  Fructose and mannose metabolism
mgp00052  Galactose metabolism
mgp01100  Metabolic pathways
mgp01200  Carbon metabolism
mgp01230  Biosynthesis of amino acids
mgp03018  RNA degradation
Module
mgp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100549777 (PFKP)
   00030 Pentose phosphate pathway
    100549777 (PFKP)
   00051 Fructose and mannose metabolism
    100549777 (PFKP)
   00052 Galactose metabolism
    100549777 (PFKP)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100549777 (PFKP)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100549777 (PFKP)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100549777 (PFKP)
Messenger RNA biogenesis [BR:mgp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100549777 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100549777
NCBI-ProteinID: XP_010710837
Ensembl: ENSMGAG00000005583
Position
6
AA seq 477 aa AA seqDB search
MAQHPAAGRQPSGRTGPYSSEAAQAPQHHLHWRRQEAPPAMLARPAACPRAGYQGMVDGG
DNIVEVSWESVSSILQVGGTVIGSARCKSFRTREGRLQAACNLVQRGITNLCVIGGDGSL
TGANLFREEWSGLLEELAQKGKIDEEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDSAL
HRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWEDS
MCVKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQRG
GTPSAFDRILASRMGVEAVLALLEATPDTPACVVSLSGNQAVRLPLMECVQMTQEVQKAM
DEGRFVEAVRLRGRSFENNLNTYKLLSQKKPDAELPKTNFNVAVLNVGAPAAGMNAAVRA
AVRVGITEGHKMFAVIDGFEGFARGKVSIVLCIPSHSTILFMFLEVVFCGTLMRSDS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcaccccgcagcaggccgacaaccgagcggacgaaccgggccgtacagcagc
gaagcagcgcaggcgccgcagcaccacctgcattggcggcggcaggaagccccgcccgcc
atgttggcccgtcccgctgcgtgcccgagggcgggttaccaaggaatggttgatggcggt
gataatattgttgaagtttcttgggaaagtgtatccagtatcctgcaagtgggaggtaca
gtgattggtagtgcacgctgcaaatcctttcgtacccgggagggtcgcctgcaggcagcc
tgcaacttggttcagagaggaatcactaatctttgtgtgattggtggagatggtagctta
actggtgccaatctgttccgtgaagaatggagtggacttctagaagaactggcgcagaaa
ggaaagattgatgaagaagctgttaagaaatatgcttaccttaacattgtgggaatggtt
gggtccatagacaatgacttctgtggtactgatatgaccataggaactgactcagccttg
cacagaatcattgaagttgtggatgccatcatgaccactgcacaaagccatcagaggaca
tttgttctggaggttatggggagacactgtgggtatttagctcttgtcagtgccttagct
tgtggtgcagattgggtatttattcctgaatacccaccagaggaaggatgggaggattca
atgtgtgttaagctttcagagaaccgtgcacgaaagaaaaggctgaatattattatcgta
gctgaaggtgctattgactgccacaacaaacctataacatcagagaaggttaaggatctt
gtggttcagcggcttggattcgacacccgagtgactatcttgggtcatgtgcaaagaggt
ggaactccttcagcttttgatagaattttggcaagccgaatgggtgtggaagctgtactt
gcacttctagaagctactccagatactcctgcctgtgttgtgtctctgtctggaaaccaa
gctgtccgtctgcctttgatggagtgtgtgcagatgactcaagaagtacagaaagccatg
gatgaaggaagatttgttgaggctgtgaggcttcgtgggaggagctttgaaaacaacctt
aacacctacaaattactgtcacaaaaaaagccagatgccgagcttccaaagaccaatttt
aatgtggcagtcttaaatgttggtgcacctgcagctggaatgaatgctgcagtgagggct
gcagtgagagttggcataactgaaggccataaaatgtttgctgtcattgatggatttgaa
ggttttgctagagggaaggtcagtatagtattgtgtatcccatcccactctaccattttg
ttcatgttcttggaagttgtcttctgtggaactcttatgagaagtgattcttaa

DBGET integrated database retrieval system