KEGG   Meleagris gallopavo (turkey): 100549991Help
Entry
100549991         CDS       T01523                                 

Definition
(RefSeq) arylamine N-acetyltransferase, liver isozyme
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00232  Caffeine metabolism
mgp00983  Drug metabolism - other enzymes
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100549991
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100549991
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     100549991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 100549991
NCBI-ProteinID: XP_003209904
Ensembl: ENSMGAG00000015618
UniProt: G1NRE1
Position
13
AA seq 296 aa AA seqDB search
MNIQEYFSRISFDGSHKDADLQTLTAIFQCHIQAIPFENLSMHCGETIDLDLQSTYDKIV
KKKRGGWCMETNYLLFWALKEMGYEVCVLGGNSYDPAKRAYIDQINHILLKVVIKGSSYI
VDAGFGGGPYQTWLPMLLISGKDQPQIPGIFRFTEDNGIWYLEKVKRKHYVPEGSVPLSD
TPEMGNIRKLYSFTLEPKHIDDFQELNTYLQVSPDTILQKKSICSLQTTEGFYALVGWTF
SEMKYKYKEDTDLLQTTTLTDEEIAKTLKEKFNIVLENKLIPVNVRGLPPNLVDSI
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcaagagtatttctcaagaatttcttttgatggctcccataaggatgcagac
ttgcaaaccttaacagccatcttccagtgtcacatccaggcgattccttttgaaaacctc
agcatgcactgcggagagaccattgacctggatttgcaatctacttacgataaaatagtg
aaaaagaaacgtggtggatggtgcatggaaacaaactaccttttattttgggctttgaaa
gaaatggggtatgaagtctgtgtgcttggaggaaacagttatgacccagcaaagagggca
tacattgatcaaataaatcacatcctactgaaagttgtgatcaagggaagttcctacata
gtagatgctggttttggtggtggtccctaccaaacatggctgccaatgttgctgatttct
gggaaggatcaaccccagattcctggcatcttccgcttcacagaagacaatggcatctgg
tacttggagaaagtcaagaggaaacattatgttccagagggaagtgttcctctctctgat
actccagaaatgggcaatatcagaaaactatattcattcactcttgagccaaaacatata
gatgacttccaggagctaaacacatacctacaagtgtctccggataccatacttcagaag
aagtcaatctgcagcctccagaccactgaagggttttatgccttagttggatggaccttc
tctgagatgaagtacaagtacaaggaggacacagacctgctgcagaccacaaccctcaca
gatgaagagatcgctaagacactgaaagaaaaattcaacatagtgttagagaacaaattg
ataccagtaaatgttcgtggcttgccacctaatctagtggattccatataa

DBGET integrated database retrieval system