KEGG   Meleagris gallopavo (turkey): 100550608Help
Entry
100550608         CDS       T01523                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00561  Glycerolipid metabolism
mgp01100  Metabolic pathways
Module
mgp_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100550608 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mgp01002]
    100550608 (MGLL)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100550608 (MGLL)
Peptidases [BR:mgp01002]
 Serine Peptidases
  Family S33
   100550608 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Esterase DLH Abhydrolase_2 Lipase_3 PGAP1 Thioesterase Abhydrolase_5 DUF1350 DUF2436 LIP LIDHydrolase DUF2048
Motif
Other DBs
NCBI-GeneID: 100550608
NCBI-ProteinID: XP_003210148
Ensembl: ENSMGAG00000007336
Position
14
AA seq 311 aa AA seqDB search
MKTGHSSRMPEESSPKRSPQNIPYKDLPHIVNADGQHLFCRYWKPAAAARALVFIAHGAG
EHCGRYDDLAQRLTELNLFVFAHDHVGHGQSEGDRMVVSDFHVFIRDSLQHIDLMKKDHP
GLPIFILGHSMGGAISILTASERPSDFSGMLLISPLVVASPEVATPIKVFAAKVLNLVLP
NLSLGSIDPNAISRNKKEMESYTSDPLVYHGGMKVSFVIQLMNAITRIERALPKLTLPIL
VLHGSSDKLCDIKGSYLLMDTVQSQDKTLKVYEEAYHALHKELPEVTASVFTEILTWVGQ
KVSAAGETSQT
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggtcattcatccagaatgcccgaggaaagttcaccaaagcggagtcctcaa
aacatcccatacaaggacctgccccacatcgtcaacgctgatgggcagcacctcttctgc
aggtactggaagccagcagcagctgccagggccctcgtgtttatcgctcatggcgctggg
gaacactgcggccgttatgatgacttggcccagaggctgacagaacttaacttgtttgta
tttgcccatgaccatgttggccatgggcagagcgagggggatcggatggttgtctccgat
ttccacgtcttcatcagggacagcttacagcacatcgatctcatgaaaaaggatcatcca
gggctgcccatcttcatcctggggcactccatggggggagccatctccattctgacagcc
agcgagagacccagtgacttttcaggcatgctgctaatctctcctctggtggttgctagc
ccagaagttgccacccccatcaaggtttttgcagcaaaagtactcaacctcgtgcttcca
aacttgtcactgggatcaatagatccaaatgcaatttcccggaacaagaaggagatggag
tcctacacgtctgaccccctggtctaccacggtggcatgaaggtctcctttgtcatccag
ctgatgaatgccattaccagaatcgagcgagctctgcccaagctgactctgcccatcctg
gtgctgcatggctcttctgacaagctctgtgatatcaaaggctcctatttactgatggac
acggttcagagccaggacaaaacgctgaaggtgtatgaggaagcctaccatgcactgcac
aaagagctgcctgaggtcaccgcctccgtcttcacagaaatactgacgtgggttggccag
aaggtttcagcagctggagaaaccagccagacctaa

DBGET integrated database retrieval system